PDB entry 4wcf

View 4wcf on RCSB PDB site
Description: Trypanosoma brucei PTR1 in complex with inhibitor 9
Class: oxidoreductase
Keywords: Oxidoreductase
Deposited on 2014-09-04, released 2015-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wcfa_
  • Chain 'B':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wcfb_
  • Chain 'C':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wcfc_
  • Chain 'D':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wcfd_
  • Heterogens: NAP, 3KN, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wcfA (A:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wcfA (A:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
    pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
    ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
    dgglslvha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wcfB (B:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wcfB (B:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
    pflltmsfaqrqnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirvn
    gvapgvsllpamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdg
    glslvha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wcfC (C:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wcfC (C:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvktvetqvaeligtnaiap
    flltmsfaqrqnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirvng
    vapgvsllpamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgg
    lslvha
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wcfD (D:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wcfD (D:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgktvetqvaeligtnai
    apflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygir
    vngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiik
    vdgglslvha