PDB entry 4wbt

View 4wbt on RCSB PDB site
Description: Crystal structure of histidinol-phosphate aminotransferase from Sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
Class: transferase
Keywords: Histidinol-phosphate aminotransferase, Pyridoxal-5'-phosphate, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC
Deposited on 2014-09-03, released 2014-09-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.147
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable histidinol-phosphate aminotransferase
    Species: Rhizobium meliloti [TaxId:266834]
    Gene: hisC4, R01049, SMc02393
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92R63 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.05: d4wbta_
  • Chain 'B':
    Compound: Probable histidinol-phosphate aminotransferase
    Species: Rhizobium meliloti [TaxId:266834]
    Gene: hisC4, R01049, SMc02393
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92R63 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d4wbtb_
  • Chain 'C':
    Compound: Probable histidinol-phosphate aminotransferase
    Species: Rhizobium meliloti [TaxId:266834]
    Gene: hisC4, R01049, SMc02393
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92R63 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d4wbtc_
  • Heterogens: PLP, GOL, PEG, PGE, PE4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wbtA (A:)
    fqsmsafsrftpliqslpasvpfvgpealerqhgrkiaariganesgfgpapsvllairq
    aagdtwkyadpenhdlkqalarhlgtspaniaigegidgllgqivrlvveagapvvtslg
    gyptfnyhvaghggrlvtvpyaddredlegllaavgrenaplvylanpdnpmgswwpaer
    vvafaqalpettllvldeaycetaprdalppieslidkpnvirartfskayglagarigy
    tlstpgtaqafdkirnhfgmsrigvaaaiaaladqdylkevtlkiansrqrigriaadsg
    laplpsatnfvavdcgkdasyaraivdrlmsdhgifirmpgvaplnrciristapdaemd
    llaaalpevirslaat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wbtA (A:)
    fqsmsafsrftpliqslfvgpealerqhgrkiaariganesgfgpapsvllairqaagdt
    wkyadpenhdlkqalarhlgtspaniaigegidgllgqivrlvveagapvvtslggyptf
    nyhvaghggrlvtvpyaddredlegllaavgrenaplvylanpdnpmgswwpaervvafa
    qalpettllvldeaycetaprdalppieslidkpnvirartfskayglagarigytlstp
    gtaqafdkirnhfgmsrigvaaaiaaladqdylkevtlkiansrqrigriaadsglaplp
    satnfvavdcgkdasyaraivdrlmsdhgifirmpgvaplnrciristapdaemdllaaa
    lpevirsla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wbtB (B:)
    fqsmsafsrftpliqslpasvpfvgpealerqhgrkiaariganesgfgpapsvllairq
    aagdtwkyadpenhdlkqalarhlgtspaniaigegidgllgqivrlvveagapvvtslg
    gyptfnyhvaghggrlvtvpyaddredlegllaavgrenaplvylanpdnpmgswwpaer
    vvafaqalpettllvldeaycetaprdalppieslidkpnvirartfskayglagarigy
    tlstpgtaqafdkirnhfgmsrigvaaaiaaladqdylkevtlkiansrqrigriaadsg
    laplpsatnfvavdcgkdasyaraivdrlmsdhgifirmpgvaplnrciristapdaemd
    llaaalpevirslaat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wbtB (B:)
    smsafsrftpliqslpfvgpealerqhgrkiaariganesgfgpapsvllairqaagdtw
    kyadpenhdlkqalarhlgtspaniaigegidgllgqivrlvveagapvvtslggyptfn
    yhvaghggrlvtvpyaddredlegllaavgrenaplvylanpdnpmgswwpaervvafaq
    alpettllvldeaycetaprdalppieslidkpnvirartfskayglagarigytlstpg
    taqafdkirnhfgmsrigvaaaiaaladqdylkevtlkiansrqrigriaadsglaplps
    atnfvavdcgkdasyaraivdrlmsdhgifirmpgvaplnrciristapdaemdllaaal
    pevirsla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wbtC (C:)
    fqsmsafsrftpliqslpasvpfvgpealerqhgrkiaariganesgfgpapsvllairq
    aagdtwkyadpenhdlkqalarhlgtspaniaigegidgllgqivrlvveagapvvtslg
    gyptfnyhvaghggrlvtvpyaddredlegllaavgrenaplvylanpdnpmgswwpaer
    vvafaqalpettllvldeaycetaprdalppieslidkpnvirartfskayglagarigy
    tlstpgtaqafdkirnhfgmsrigvaaaiaaladqdylkevtlkiansrqrigriaadsg
    laplpsatnfvavdcgkdasyaraivdrlmsdhgifirmpgvaplnrciristapdaemd
    llaaalpevirslaat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wbtC (C:)
    smsafsrftpliqslfvgpealerqhgrkiaariganesgfgpapsvllairqaagdtwk
    yadpenhdlkqalarhlgtspaniaigegidgllgqivrlvveagapvvtslggyptfny
    hvaghggrlvtvpyaddredlegllaavgrenaplvylanpdnpmgswwpaervvafaqa
    lpettllvldeaycetaprdalppieslidkpnvirartfskayglagarigytlstpgt
    aqafdkirnhfgmsrigvaaaiaaladqdylkevtlkiansrqrigriaadsglaplpsa
    tnfvavdcgkdasyaraivdrlmsdhgifirmpgvaplnrciristapdaemdllaaalp
    evirsla