PDB entry 4wbs

View 4wbs on RCSB PDB site
Description: Crystal structure of an ABC transporter related protein from Burkholderia phymatum
Class: transport protein
Keywords: SSGCID, ABC transporter, Burkholderia phymatum, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSPORT PROTEIN
Deposited on 2014-09-03, released 2014-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC transporter related
    Species: Burkholderia phymatum [TaxId:391038]
    Gene: Bphy_0327
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wbsa_
  • Chain 'B':
    Compound: ABC transporter related
    Species: Burkholderia phymatum [TaxId:391038]
    Gene: Bphy_0327
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wbsb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wbsA (A:)
    mahhhhhhmgtleaqtqgpgsmvsapalpnrkpagtssslvvrnlkkrygsrtvvkdvsl
    dvksgevvgllgpngagkttsfymivglvpldageidldgksisllpihkraslglsylp
    qeasvfrklsveeniravlelqvgddgkrlskdaiasrtealldelqishlrenpalsls
    ggerrrveiaralatnpsfilldepfagvdpiavleiqkivkflkqrnigvlitdhnvre
    tlgicdhayiisdgsvlaagapgdiienesvrrvylgehfrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wbsA (A:)
    ssslvvrnlkkrygsrtvvkdvsldvksgevvgllgpngagkttsfymivglvpldagei
    dldgksisllpihkraslglsylpqeasvfrklsveeniravlelqvgddgkrlskdaia
    srtealldelqishlrenpalslsggerrrveiaralatnpsfilldepfagvdpiavle
    iqkivkflkqrnigvlitdhnvretlgicdhayiisdgsvlaagapgdiienesvrrvyl
    gehfrm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wbsB (B:)
    mahhhhhhmgtleaqtqgpgsmvsapalpnrkpagtssslvvrnlkkrygsrtvvkdvsl
    dvksgevvgllgpngagkttsfymivglvpldageidldgksisllpihkraslglsylp
    qeasvfrklsveeniravlelqvgddgkrlskdaiasrtealldelqishlrenpalsls
    ggerrrveiaralatnpsfilldepfagvdpiavleiqkivkflkqrnigvlitdhnvre
    tlgicdhayiisdgsvlaagapgdiienesvrrvylgehfrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wbsB (B:)
    sapalpnrkpagtssslvvrnlkkrygsrtvvkdvsldvksgevvgllgpngagkttsfy
    mivglvpldageidldgksisllpihkraslglsylpqeasvfrklsveeniravlelqv
    ggkrlskdaiasrtealldelqishlrenpalslsggerrrveiaralatnpsfilldep
    fagvdpiavleiqkivkflkqrnigvlitdhnvretlgicdhayiisdgsvlaagapgdi
    ienesvrrvylgehfrm