PDB entry 4was

View 4was on RCSB PDB site
Description: structure of the etr1p/nadp/crotonyl-coa complex
Class: oxidoreductase
Keywords: mitochondrial fatty acid synthesis, oxidoreductase
Deposited on 2014-08-31, released 2015-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-[acyl-carrier-protein] reductase [nadph, b-specific] 1, mitochondrial
    Species: Candida tropicalis [TaxId:5482]
    Gene: ETR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4wasa1, d4wasa2
  • Chain 'B':
    Compound: enoyl-[acyl-carrier-protein] reductase [nadph, b-specific] 1, mitochondrial
    Species: Candida tropicalis [TaxId:5482]
    Gene: ETR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4wasb1, d4wasb2
  • Chain 'C':
    Compound: enoyl-[acyl-carrier-protein] reductase [nadph, b-specific] 1, mitochondrial
    Species: Candida tropicalis [TaxId:5482]
    Gene: ETR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4wasc1, d4wasc2
  • Heterogens: NAP, COO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wasA (A:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wasB (B:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wasC (C:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity