PDB entry 4wa1

View 4wa1 on RCSB PDB site
Description: The crystal structure of hemagglutinin from a H3N8 influenza virus isolated from New England harbor seals
Class: viral protein
Keywords: hemagglutinin, influenza virus, seal, VIRAL PROTEIN
Deposited on 2014-08-28, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/harbor seal/Massachusetts/1/2011(H3N8)) [TaxId:1136533]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wa1a1, d4wa1a2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/harbor seal/Massachusetts/1/2011(H3N8)) [TaxId:1136533]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wa1b1, d4wa1b2
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/harbor seal/Massachusetts/1/2011(H3N8)) [TaxId:1136533]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wa1c1, d4wa1c2
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/harbor seal/Massachusetts/1/2011(H3N8)) [TaxId:1136533]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wa1d1, d4wa1d2
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/harbor seal/Massachusetts/1/2011(H3N8)) [TaxId:1136533]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wa1e1, d4wa1e2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/harbor seal/Massachusetts/1/2011(H3N8)) [TaxId:1136533]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wa1f1, d4wa1f2
  • Heterogens: NAG, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wa1A (A:)
    nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
    dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
    tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
    nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqstlklatgmrnvpekqtrglfgaiagfiengwegmidgwygfrhknsegtgqaadl
    kstqaaidqingklnrviektnekfhqiekeflevegriqdlekyvedtkidlwsynael
    lvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtyd
    hdiyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wa1A (A:)
    nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
    dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
    tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
    nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqstlklatgmrnvpglfgaiagfiengwegmidgwygfrhknsegtgqaadlkstqa
    aidqingklnrviektnekfhqiekeflevegriqdlekyvedtkidlwsynaellvale
    nqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyr
    dealnnrfqik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wa1B (B:)
    nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
    dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
    tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
    nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqstlklatgmrnvpekqtrglfgaiagfiengwegmidgwygfrhknsegtgqaadl
    kstqaaidqingklnrviektnekfhqiekeflevegriqdlekyvedtkidlwsynael
    lvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtyd
    hdiyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wa1B (B:)
    nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
    dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
    tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
    nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqstlklatgmrnvpglfgaiagfiengwegmidgwygfrhknsegtgqaadlkstqa
    aidqingklnrviektnekfhqiekeflevegriqdlekyvedtkidlwsynaellvale
    nqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyr
    dealnnrfqik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wa1C (C:)
    nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
    dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
    tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
    nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqstlklatgmrnvpekqtrglfgaiagfiengwegmidgwygfrhknsegtgqaadl
    kstqaaidqingklnrviektnekfhqiekeflevegriqdlekyvedtkidlwsynael
    lvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtyd
    hdiyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wa1C (C:)
    nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
    dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
    tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
    nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqstlklatgmrnvpglfgaiagfiengwegmidgwygfrhknsegtgqaadlkstqa
    aidqingklnrviektnekfhqiekeflevegriqdlekyvedtkidlwsynaellvale
    nqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyr
    dealnnrfqik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wa1D (D:)
    nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
    dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
    tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
    nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqstlklatgmrnvpekqtrglfgaiagfiengwegmidgwygfrhknsegtgqaadl
    kstqaaidqingklnrviektnekfhqiekeflevegriqdlekyvedtkidlwsynael
    lvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtyd
    hdiyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wa1D (D:)
    nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
    dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
    tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
    nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqstlklatgmrnvpglfgaiagfiengwegmidgwygfrhknsegtgqaadlkstqa
    aidqingklnrviektnekfhqiekeflevegriqdlekyvedtkidlwsynaellvale
    nqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyr
    dealnnrfqik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4wa1E (E:)
    nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
    dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
    tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
    nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqstlklatgmrnvpekqtrglfgaiagfiengwegmidgwygfrhknsegtgqaadl
    kstqaaidqingklnrviektnekfhqiekeflevegriqdlekyvedtkidlwsynael
    lvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtyd
    hdiyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wa1E (E:)
    nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
    dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
    tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
    nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqstlklatgmrnvpglfgaiagfiengwegmidgwygfrhknsegtgqaadlkstqa
    aidqingklnrviektnekfhqiekeflevegriqdlekyvedtkidlwsynaellvale
    nqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyr
    dealnnrfqik
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4wa1F (F:)
    nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
    dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
    tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
    nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqstlklatgmrnvpekqtrglfgaiagfiengwegmidgwygfrhknsegtgqaadl
    kstqaaidqingklnrviektnekfhqiekeflevegriqdlekyvedtkidlwsynael
    lvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtyd
    hdiyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wa1F (F:)
    nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
    dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
    tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
    nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqstlklatgmrnvpglfgaiagfiengwegmidgwygfrhknsegtgqaadlkstqa
    aidqingklnrviektnekfhqiekeflevegriqdlekyvedtkidlwsynaellvale
    nqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyr
    dealnnrfqik