PDB entry 4w9a

View 4w9a on RCSB PDB site
Description: Crystal structure of Gamma-B Crystallin expressed in E. coli based on mRNA variant 2
Class: structural protein
Keywords: Eye lens protein, structural protein
Deposited on 2014-08-27, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-crystallin B
    Species: Bos taurus [TaxId:9913]
    Gene: CRYGB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4w9aa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4w9aA (A:)
    mgkitfyedrgfqghcyecssdcpnlqpyfsrcnsirvdsgcwmlyerpnyqghqyflrr
    gdypdyqqwmgfndsirscrlipqhtgtfrmriyerddfrgqmseitddcpslqdrfhlt
    evhslnvlegswvlyempsyrgrqyllrpgeyrryldwgamnakvgslrrvmdfyhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w9aA (A:)
    gkitfyedrgfqghcyecssdcpnlqpyfsrcnsirvdsgcwmlyerpnyqghqyflrrg
    dypdyqqwmgfndsirscrlipqhtgtfrmriyerddfrgqmseitddcpslqdrfhlte
    vhslnvlegswvlyempsyrgrqyllrpgeyrryldwgamnakvgslrrvmd