SCOPe 2.06: Structural Classification of Proteins

PDB entry 4w91

View 4w91 on RCSB PDB site
Description: Crystal structure of a cysteine desulfurase SufS from Brucella suis bound to PLP
Class: transferase
Keywords: structural genomics, National Institute for Allergy and Infectious Disease, NIAID, Seattle Structural Genomics Center for Infectious Disease (SSGCID), pyridoxal-5-phosphate, PLP, LLP
Deposited on 2014-08-26, released 2014-10-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.238
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: aminotransferase
Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
Gene: BAVG_0632
Database cross-references and differences (RAF-indexed):
- Uniprot D0BBJ1 (Start-421)
Domains in SCOPe 2.06: d4w91a_
Chain 'B':
Compound: aminotransferase
Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
Gene: BAVG_0632
Database cross-references and differences (RAF-indexed):
- Uniprot D0BBJ1 (Start-421)
Domains in SCOPe 2.06: d4w91b_
Chain 'C':
Compound: aminotransferase
Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
Gene: BAVG_0632
Database cross-references and differences (RAF-indexed):
- Uniprot D0BBJ1 (Start-421)
Domains in SCOPe 2.06: d4w91c_
Chain 'D':
Compound: aminotransferase
Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
Gene: BAVG_0632
Database cross-references and differences (RAF-indexed):
- Uniprot D0BBJ1 (Start-421)
Domains in SCOPe 2.06: d4w91d_
Chain 'E':
Compound: aminotransferase
Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
Gene: BAVG_0632
Database cross-references and differences (RAF-indexed):
- Uniprot D0BBJ1 (Start-421)
Domains in SCOPe 2.06: d4w91e_
Chain 'F':
Compound: aminotransferase
Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
Gene: BAVG_0632
Database cross-references and differences (RAF-indexed):
- Uniprot D0BBJ1 (Start-421)
Domains in SCOPe 2.06: d4w91f_
Chain 'G':
Compound: aminotransferase
Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
Gene: BAVG_0632
Database cross-references and differences (RAF-indexed):
- Uniprot D0BBJ1
Domains in SCOPe 2.06: d4w91g_
Chain 'H':
Compound: aminotransferase
Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
Gene: BAVG_0632
Database cross-references and differences (RAF-indexed):
- Uniprot D0BBJ1 (Start-421)
Domains in SCOPe 2.06: d4w91h_
Chain 'I':
Compound: aminotransferase
Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
Gene: BAVG_0632
Database cross-references and differences (RAF-indexed):
- Uniprot D0BBJ1 (Start-421)
Domains in SCOPe 2.06: d4w91i_
Chain 'J':
Compound: aminotransferase
Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
Gene: BAVG_0632
Database cross-references and differences (RAF-indexed):
- Uniprot D0BBJ1
Domains in SCOPe 2.06: d4w91j_
Heterogens: CL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4w91A (A:)
mahhhhhhmdqknpltmaydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavt
hayaneyanvhrglhflsnaatdayeksretvrrflnagsvdeivftknateaintvayg
ygmpfigegdeillsimehhsnivpwhfirerqgaklvftpvddngvfhieefekrlser
tklvaithmsntlgtvvpikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftg
hkvygpsgigvlygraqmlekmrpfqgggemieevteenvtynhpphrfeagtppivqai
glgaaleymekigrhailaheadlrdyaherlgrinslrifgnapdkgaiisfalegiha
hdvsmvidragvavragthcaqpllkrfgvtstcrasfalyntraevdalaealekarkf
fg