PDB entry 4w91

View 4w91 on RCSB PDB site
Description: Crystal structure of a cysteine desulfurase SufS from Brucella suis bound to PLP
Class: transferase
Keywords: structural genomics, National Institute for Allergy and Infectious Disease, NIAID, Seattle Structural Genomics Center for Infectious Disease (SSGCID), pyridoxal-5-phosphate, PLP, LLP
Deposited on 2014-08-26, released 2014-10-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.238
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminotransferase
    Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
    Gene: BAVG_0632
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4w91a_
  • Chain 'B':
    Compound: aminotransferase
    Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
    Gene: BAVG_0632
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4w91b_
  • Chain 'C':
    Compound: aminotransferase
    Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
    Gene: BAVG_0632
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4w91c_
  • Chain 'D':
    Compound: aminotransferase
    Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
    Gene: BAVG_0632
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4w91d_
  • Chain 'E':
    Compound: aminotransferase
    Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
    Gene: BAVG_0632
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4w91e_
  • Chain 'F':
    Compound: aminotransferase
    Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
    Gene: BAVG_0632
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4w91f_
  • Chain 'G':
    Compound: aminotransferase
    Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
    Gene: BAVG_0632
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4w91g_
  • Chain 'H':
    Compound: aminotransferase
    Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
    Gene: BAVG_0632
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4w91h_
  • Chain 'I':
    Compound: aminotransferase
    Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
    Gene: BAVG_0632
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4w91i_
  • Chain 'J':
    Compound: aminotransferase
    Species: Brucella suis bv. 4 str. 40 [TaxId:520488]
    Gene: BAVG_0632
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4w91j_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4w91A (A:)
    mahhhhhhmdqknpltmaydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavt
    hayaneyanvhrglhflsnaatdayeksretvrrflnagsvdeivftknateaintvayg
    ygmpfigegdeillsimehhsnivpwhfirerqgaklvftpvddngvfhieefekrlser
    tklvaithmsntlgtvvpikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftg
    hkvygpsgigvlygraqmlekmrpfqgggemieevteenvtynhpphrfeagtppivqai
    glgaaleymekigrhailaheadlrdyaherlgrinslrifgnapdkgaiisfalegiha
    hdvsmvidragvavragthcaqpllkrfgvtstcrasfalyntraevdalaealekarkf
    fg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w91A (A:)
    ydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavthayaneyanvhrglhfls
    naatdayeksretvrrflnagsvdeivftknateaintvaygygmpfigegdeillsime
    hhsnivpwhfirerqgaklvftpvddngvfhieefekrlsertklvaithmsntlgtvvp
    ikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftghkvygpsgigvlygraqm
    lekmrpfqgggemieevteenvtynhpphrfeagtppivqaiglgaaleymekigrhail
    aheadlrdyaherlgrinslrifgnapdkgaiisfalegihahdvsmvidragvavragt
    hcaqpllkrfgvtstcrasfalyntraevdalaealekarkffg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4w91B (B:)
    mahhhhhhmdqknpltmaydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavt
    hayaneyanvhrglhflsnaatdayeksretvrrflnagsvdeivftknateaintvayg
    ygmpfigegdeillsimehhsnivpwhfirerqgaklvftpvddngvfhieefekrlser
    tklvaithmsntlgtvvpikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftg
    hkvygpsgigvlygraqmlekmrpfqgggemieevteenvtynhpphrfeagtppivqai
    glgaaleymekigrhailaheadlrdyaherlgrinslrifgnapdkgaiisfalegiha
    hdvsmvidragvavragthcaqpllkrfgvtstcrasfalyntraevdalaealekarkf
    fg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w91B (B:)
    aydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavthayaneyanvhrglhfl
    snaatdayeksretvrrflnagsvdeivftknateaintvaygygmpfigegdeillsim
    ehhsnivpwhfirerqgaklvftpvddngvfhieefekrlsertklvaithmsntlgtvv
    pikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftghkvygpsgigvlygraq
    mlekmrpfqgggemieevteenvtynhpphrfeagtppivqaiglgaaleymekigrhai
    laheadlrdyaherlgrinslrifgnapdkgaiisfalegihahdvsmvidragvavrag
    thcaqpllkrfgvtstcrasfalyntraevdalaealekarkffg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4w91C (C:)
    mahhhhhhmdqknpltmaydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavt
    hayaneyanvhrglhflsnaatdayeksretvrrflnagsvdeivftknateaintvayg
    ygmpfigegdeillsimehhsnivpwhfirerqgaklvftpvddngvfhieefekrlser
    tklvaithmsntlgtvvpikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftg
    hkvygpsgigvlygraqmlekmrpfqgggemieevteenvtynhpphrfeagtppivqai
    glgaaleymekigrhailaheadlrdyaherlgrinslrifgnapdkgaiisfalegiha
    hdvsmvidragvavragthcaqpllkrfgvtstcrasfalyntraevdalaealekarkf
    fg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w91C (C:)
    ydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavthayaneyanvhrglhfls
    naatdayeksretvrrflnagsvdeivftknateaintvaygygmpfigegdeillsime
    hhsnivpwhfirerqgaklvftpvddngvfhieefekrlsertklvaithmsntlgtvvp
    ikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftghkvygpsgigvlygraqm
    lekmrpfqgggemieevteenvtynhpphrfeagtppivqaiglgaaleymekigrhail
    aheadlrdyaherlgrinslrifgnapdkgaiisfalegihahdvsmvidragvavragt
    hcaqpllkrfgvtstcrasfalyntraevdalaealekarkffg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4w91D (D:)
    mahhhhhhmdqknpltmaydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavt
    hayaneyanvhrglhflsnaatdayeksretvrrflnagsvdeivftknateaintvayg
    ygmpfigegdeillsimehhsnivpwhfirerqgaklvftpvddngvfhieefekrlser
    tklvaithmsntlgtvvpikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftg
    hkvygpsgigvlygraqmlekmrpfqgggemieevteenvtynhpphrfeagtppivqai
    glgaaleymekigrhailaheadlrdyaherlgrinslrifgnapdkgaiisfalegiha
    hdvsmvidragvavragthcaqpllkrfgvtstcrasfalyntraevdalaealekarkf
    fg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w91D (D:)
    ydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavthayaneyanvhrglhfls
    naatdayeksretvrrflnagsvdeivftknateaintvaygygmpfigegdeillsime
    hhsnivpwhfirerqgaklvftpvddngvfhieefekrlsertklvaithmsntlgtvvp
    ikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftghkvygpsgigvlygraqm
    lekmrpfqgggemieevteenvtynhpphrfeagtppivqaiglgaaleymekigrhail
    aheadlrdyaherlgrinslrifgnapdkgaiisfalegihahdvsmvidragvavragt
    hcaqpllkrfgvtstcrasfalyntraevdalaealekarkffg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4w91E (E:)
    mahhhhhhmdqknpltmaydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavt
    hayaneyanvhrglhflsnaatdayeksretvrrflnagsvdeivftknateaintvayg
    ygmpfigegdeillsimehhsnivpwhfirerqgaklvftpvddngvfhieefekrlser
    tklvaithmsntlgtvvpikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftg
    hkvygpsgigvlygraqmlekmrpfqgggemieevteenvtynhpphrfeagtppivqai
    glgaaleymekigrhailaheadlrdyaherlgrinslrifgnapdkgaiisfalegiha
    hdvsmvidragvavragthcaqpllkrfgvtstcrasfalyntraevdalaealekarkf
    fg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w91E (E:)
    ydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavthayaneyanvhrglhfls
    naatdayeksretvrrflnagsvdeivftknateaintvaygygmpfigegdeillsime
    hhsnivpwhfirerqgaklvftpvddngvfhieefekrlsertklvaithmsntlgtvvp
    ikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftghkvygpsgigvlygraqm
    lekmrpfqgggemieevteenvtynhpphrfeagtppivqaiglgaaleymekigrhail
    aheadlrdyaherlgrinslrifgnapdkgaiisfalegihahdvsmvidragvavragt
    hcaqpllkrfgvtstcrasfalyntraevdalaealekarkffg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4w91F (F:)
    mahhhhhhmdqknpltmaydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavt
    hayaneyanvhrglhflsnaatdayeksretvrrflnagsvdeivftknateaintvayg
    ygmpfigegdeillsimehhsnivpwhfirerqgaklvftpvddngvfhieefekrlser
    tklvaithmsntlgtvvpikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftg
    hkvygpsgigvlygraqmlekmrpfqgggemieevteenvtynhpphrfeagtppivqai
    glgaaleymekigrhailaheadlrdyaherlgrinslrifgnapdkgaiisfalegiha
    hdvsmvidragvavragthcaqpllkrfgvtstcrasfalyntraevdalaealekarkf
    fg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w91F (F:)
    ydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavthayaneyanvhrglhfls
    naatdayeksretvrrflnagsvdeivftknateaintvaygygmpfigegdeillsime
    hhsnivpwhfirerqgaklvftpvddngvfhieefekrlsertklvaithmsntlgtvvp
    ikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftghkvygpsgigvlygraqm
    lekmrpfqgggemieevteenvtynhpphrfeagtppivqaiglgaaleymekigrhail
    aheadlrdyaherlgrinslrifgnapdkgaiisfalegihahdvsmvidragvavragt
    hcaqpllkrfgvtstcrasfalyntraevdalaealekarkffg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4w91G (G:)
    mahhhhhhmdqknpltmaydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavt
    hayaneyanvhrglhflsnaatdayeksretvrrflnagsvdeivftknateaintvayg
    ygmpfigegdeillsimehhsnivpwhfirerqgaklvftpvddngvfhieefekrlser
    tklvaithmsntlgtvvpikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftg
    hkvygpsgigvlygraqmlekmrpfqgggemieevteenvtynhpphrfeagtppivqai
    glgaaleymekigrhailaheadlrdyaherlgrinslrifgnapdkgaiisfalegiha
    hdvsmvidragvavragthcaqpllkrfgvtstcrasfalyntraevdalaealekarkf
    fg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w91G (G:)
    ydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavthayaneyanvhrglhfls
    naatdayeksretvrrflnagsvdeivftknateaintvaygygmpfigegdeillsime
    hhsnivpwhfirerqgaklvftpvddngvfhieefekrlsertklvaithmsntlgtvvp
    ikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftghkvygpsgigvlygraqm
    lekmrpfqgggemieevteenvtynhpphrfeagtppivqaiglgaaleymekigrhail
    aheadlrdyaherlgrinslrifgnapdkgaiisfalegihahdvsmvidragvavragt
    hcaqpllkrfgvtstcrasfalyntraevdalaealekarkff
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4w91H (H:)
    mahhhhhhmdqknpltmaydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavt
    hayaneyanvhrglhflsnaatdayeksretvrrflnagsvdeivftknateaintvayg
    ygmpfigegdeillsimehhsnivpwhfirerqgaklvftpvddngvfhieefekrlser
    tklvaithmsntlgtvvpikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftg
    hkvygpsgigvlygraqmlekmrpfqgggemieevteenvtynhpphrfeagtppivqai
    glgaaleymekigrhailaheadlrdyaherlgrinslrifgnapdkgaiisfalegiha
    hdvsmvidragvavragthcaqpllkrfgvtstcrasfalyntraevdalaealekarkf
    fg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w91H (H:)
    ydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavthayaneyanvhflsnaat
    dayeksretvrrflnagsvdeivftknateaintvaygygmpfigegdeillsimehhsn
    ivpwhfirerqgaklvftpvddngvfhieefekrlsertklvaithmsntlgtvvpikki
    velahargipvlvdgsqgavhlpvdvqdlgcdwyvftghkvygpsgigvlygraqmlekm
    rpfqgggemieevteenvtynhpphrfeagtppivqaiglgaaleymekigrhailahea
    dlrdyaherlgrinslrifgnapdkgaiisfalegihahdvsmvidragvavragthcaq
    pllkrfgvtstcrasfalyntraevdalaealekarkffg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4w91I (I:)
    mahhhhhhmdqknpltmaydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavt
    hayaneyanvhrglhflsnaatdayeksretvrrflnagsvdeivftknateaintvayg
    ygmpfigegdeillsimehhsnivpwhfirerqgaklvftpvddngvfhieefekrlser
    tklvaithmsntlgtvvpikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftg
    hkvygpsgigvlygraqmlekmrpfqgggemieevteenvtynhpphrfeagtppivqai
    glgaaleymekigrhailaheadlrdyaherlgrinslrifgnapdkgaiisfalegiha
    hdvsmvidragvavragthcaqpllkrfgvtstcrasfalyntraevdalaealekarkf
    fg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w91I (I:)
    ydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavthayaneyanvhhflsnaa
    tdayeksretvrrflnagsvdeivftknateaintvaygygmpfigegdeillsimehhs
    nivpwhfirerqgaklvftpvddngvfhieefekrlsertklvaithmsntlgtvvpikk
    ivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftghkvygpsgigvlygraqmlek
    mrpfqgggemieevteenvtynhpphrfeagtppivqaiglgaaleymekigrhailahe
    adlrdyaherlgrinslrifgdkgaiisfalegihahdvsmvidragvavragthcaqpl
    lkrfgvtstcrasfalyntraevdalaealekarkffg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4w91J (J:)
    mahhhhhhmdqknpltmaydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavt
    hayaneyanvhrglhflsnaatdayeksretvrrflnagsvdeivftknateaintvayg
    ygmpfigegdeillsimehhsnivpwhfirerqgaklvftpvddngvfhieefekrlser
    tklvaithmsntlgtvvpikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftg
    hkvygpsgigvlygraqmlekmrpfqgggemieevteenvtynhpphrfeagtppivqai
    glgaaleymekigrhailaheadlrdyaherlgrinslrifgnapdkgaiisfalegiha
    hdvsmvidragvavragthcaqpllkrfgvtstcrasfalyntraevdalaealekarkf
    fg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w91J (J:)
    ydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavthayaneyanvhrglhfls
    naatdayeksretvrrflnagsvdeivftknateaintvaygygmpfdeillsimehhsn
    ivpwhfirerqgaklvftpvddngvfhieefekrlsertklvaithmsntlgtvvpikki
    velahargipvlvdgsqgavhlpvdvqdlgcdwyvftghkvygpsgigvlygraqmlekm
    rpfqgggemieevteenvtynhpphrfeagtppivqaiglgaaleymekigrhailahea
    dlrdyahdkgaiisfhdvsmvidragvavragthcaqpllkrfgvtstcrasfaly