PDB entry 4w90

View 4w90 on RCSB PDB site
Description: Crystal structure of Bacillus subtilis cyclic-di-AMP riboswitch ydaO
Class: rna binding protein/rna
Keywords: riboswitch, cyclic-di-AMP, protein-RNA complex, rna binding protein-rna complex
Deposited on 2014-08-26, released 2014-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: U1 small nuclear ribonucleoprotein A
  Species: Homo sapiens [TaxId:9606]
  Gene: U1A protein
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09012 (Start-90)
    • engineered mutation (25)
    • engineered mutation (30)
  Domains in SCOPe 2.07: d4w90b_
• Chain 'C':
  Compound: riboswitch a pseudo-dimeric RNA
  Species: Bacillus subtilis [TaxId:1423]
  
• Heterogens: 2BA, MG

PDB Chain Sequences:

• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4w90B (B:)
  trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
  tnalrsmqgfpfydkpmriqyaktdsdiiak
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4w90B (B:)
  rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
  nalrsmqgfpfydkpmriqyaktdsdiiak
  

  
  
• Chain 'C':
  No sequence available.