PDB entry 4w90

View 4w90 on RCSB PDB site
Description: Crystal structure of Bacillus subtilis cyclic-di-AMP riboswitch ydaO
Class: rna binding protein/rna
Keywords: riboswitch, cyclic-di-AMP, protein-RNA complex, rna binding protein-rna complex
Deposited on 2014-08-26, released 2014-10-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: 0.236
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: U1A protein
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (Start-90)
      • engineered mutation (25)
      • engineered mutation (30)
    Domains in SCOPe 2.05: d4w90b_
  • Chain 'C':
    Compound: riboswitch a pseudo-dimeric RNA
    Species: Bacillus subtilis [TaxId:1423]
  • Heterogens: 2BA, MG

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4w90B (B:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w90B (B:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiak
    

  • Chain 'C':
    No sequence available.