PDB entry 4w90
View 4w90 on RCSB PDB site
Description: Crystal structure of Bacillus subtilis cyclic-di-AMP riboswitch ydaO
Class: rna binding protein/rna
Keywords: riboswitch, cyclic-di-AMP, protein-RNA complex, rna binding protein-rna complex
Deposited on
2014-08-26, released
2014-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-11-22, with a file datestamp of
2017-11-17.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: N/A
AEROSPACI score: 0.13
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'B':
Compound: U1 small nuclear ribonucleoprotein A
Species: Homo sapiens [TaxId:9606]
Gene: U1A protein
Database cross-references and differences (RAF-indexed):
- Uniprot P09012 (Start-90)
- engineered mutation (25)
- engineered mutation (30)
Domains in SCOPe 2.08: d4w90b_ - Chain 'C':
Compound: riboswitch a pseudo-dimeric RNA
Species: Bacillus subtilis [TaxId:1423]
- Heterogens: 2BA, MG
PDB Chain Sequences:
- Chain 'B':
Sequence, based on SEQRES records: (download)
>4w90B (B:)
trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmriqyaktdsdiiak
Sequence, based on observed residues (ATOM records): (download)
>4w90B (B:)
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdiiak
- Chain 'C':
No sequence available.