PDB entry 4w8n

View 4w8n on RCSB PDB site
Description: The crystal structure of hemagglutinin from a swine influenza virus (A/swine/Missouri/2124514/2006)
Class: viral protein
Keywords: Hemagglutinin, Influenza Virus, VIRAL PROTEIN
Deposited on 2014-08-25, released 2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:489926]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9YN66 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.07: d4w8na1, d4w8na2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:489926]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4w8nb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:489926]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9YN66 (5-329)
      • expression tag (4)
    Domains in SCOPe 2.07: d4w8nc1, d4w8nc2
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:489926]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4w8nd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:489926]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4w8ne_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:489926]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4w8nf_
  • Heterogens: NAG, NDG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4w8nA (A:)
    adlgsdqicigyhannstekvdtilernvtvthaknilekthngklcrlsgipplelgdc
    siagwllgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlltsvthfekvk
    ilprdqwtqhtttggsracavsgnpsffrnmvwltkkgsnypiakrsynntsgeqmlviw
    gihhpnddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvnglggrmefswtlletw
    dvinfestgnliapeygfkiskrgssgimktekilencetkcqtplgainttlpfhnihp
    ltigecpkyvksdrlilatglrnvpqiesr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w8nA (A:)
    sdqicigyhannstekvdtilernvtvthaknilekthngklcrlsgipplelgdcsiag
    wllgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlltsvthfekvkilpr
    dqwtqhtttggsracavsgnpsffrnmvwltkkgsnypiakrsynntsgeqmlviwgihh
    pnddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvnglggrmefswtlletwdvin
    festgnliapeygfkiskrgssgimktekilencetkcqtplgainttlpfhnihpltig
    ecpkyvksdrlilatglrnvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4w8nB (B:)
    glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkaidgitnkvnsviekmn
    tqfeavgkefnnlerrlenlnkkmedgfidvwtynaellvlmenertldfhdsnvknlyd
    kvrmqlrdnakeigngcfefyhkcddecmnsvrngtydyikyeeesklnrnesgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w8nB (B:)
    gaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkaidgitnkvnsviekmntqf
    eavgkefnnlerrlenlnkkmedgfidvwtynaellvlmenertldfhdsnvknlydkvr
    mqlrdnakeigngcfefyhkcddecmnsvrngtydyikyeeesklnrne
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4w8nC (C:)
    adlgsdqicigyhannstekvdtilernvtvthaknilekthngklcrlsgipplelgdc
    siagwllgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlltsvthfekvk
    ilprdqwtqhtttggsracavsgnpsffrnmvwltkkgsnypiakrsynntsgeqmlviw
    gihhpnddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvnglggrmefswtlletw
    dvinfestgnliapeygfkiskrgssgimktekilencetkcqtplgainttlpfhnihp
    ltigecpkyvksdrlilatglrnvpqiesr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w8nC (C:)
    sdqicigyhannstekvdtilernvtvthaknilekthngklcrlsgipplelgdcsiag
    wllgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlltsvthfekvkilpr
    dqwtqhtttggsracavsgnpsffrnmvwltkkgsnypiakrsynntsgeqmlviwgihh
    pnddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvnglggrmefswtlletwdvin
    festgnliapeygfkiskrgssgimktekilencetkcqtplgainttlpfhnihpltig
    ecpkyvksdrlilatglrnvpqiesr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4w8nD (D:)
    glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkaidgitnkvnsviekmn
    tqfeavgkefnnlerrlenlnkkmedgfidvwtynaellvlmenertldfhdsnvknlyd
    kvrmqlrdnakeigngcfefyhkcddecmnsvrngtydyikyeeesklnrnesgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w8nD (D:)
    glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkaidgitnkvnsviekmn
    tqfeavgkefnnlerrlenlnkkmedgfidvwtynaellvlmenertldfhdsnvknlyd
    kvrmqlrdnakeigngcfefyhkcddecmnsvrngtydyikyeeesklnrne
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4w8nE (E:)
    adlgsdqicigyhannstekvdtilernvtvthaknilekthngklcrlsgipplelgdc
    siagwllgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlltsvthfekvk
    ilprdqwtqhtttggsracavsgnpsffrnmvwltkkgsnypiakrsynntsgeqmlviw
    gihhpnddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvnglggrmefswtlletw
    dvinfestgnliapeygfkiskrgssgimktekilencetkcqtplgainttlpfhnihp
    ltigecpkyvksdrlilatglrnvpqiesr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w8nE (E:)
    qicigyhannstekvdtilernvtvthaknilekthngklcrlsgipplelgdcsiagwl
    lgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlltsvthfekvkilprdq
    wtqhtttggsracavsgnpsffrnmvwltkkgsnypiakrsynntsgeqmlviwgihhpn
    ddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvnglggrmefswtlletwdvinfe
    stgnliapeygfkiskrgssgimktekilencetkcqtplgainttlpfhnihpltigec
    pkyvksdrlilatglrnvp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4w8nF (F:)
    glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkaidgitnkvnsviekmn
    tqfeavgkefnnlerrlenlnkkmedgfidvwtynaellvlmenertldfhdsnvknlyd
    kvrmqlrdnakeigngcfefyhkcddecmnsvrngtydyikyeeesklnrnesgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w8nF (F:)
    fieggwqgmvdgwygyhhsndqgsgyaadkestqkaidgitnkvnsviekmntqfeavgk
    efnnlerrlenlnkkmedgfidvwtynaellvlmenertldfhdsnvknlydkvrmqlrd
    nakeigngcfefyhkcddecmnsvrngtydyikyeeesklnrne