PDB entry 4w87

View 4w87 on RCSB PDB site
Description: Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide
Class: hydrolase
Keywords: glycoside hydrolase, cell wall degrading enzyme, GH5, HYDROLASE
Deposited on 2014-08-22, released 2015-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xyloglucan-specific endo-beta-1,4-glucanase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D2K7Z0 (0-338)
      • engineered mutation (74)
    Domains in SCOPe 2.07: d4w87a_
  • Chain 'B':
    Compound: Xyloglucan-specific endo-beta-1,4-glucanase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D2K7Z0 (0-338)
      • engineered mutation (74)
    Domains in SCOPe 2.07: d4w87b_
  • Heterogens: MG, BGC, XYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4w87A (A:)
    drsrvfdilsninigwnlgntldatgggnsvnaetswgnpkttqeivdtvndrgfnairi
    pvtfanhlgpapeytisadwlarvkevvdyavndgmyiildthhetnywlktdpnneaal
    ceelaaiwkqlaeafkdydeklmfegmneprmagsakewsggtpaerklinamnkafida
    vratggnnadrvliictyghnsdeptlkdleipsdpniavalhtytpyfftyvadgsysv
    wngskknditwqynnikkylidkgipvvitetgaqfkentedivrwigdyvgtldqdgvk
    cfiwdnniyhgngekfgllnrsllkwynddivdayvnha
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4w87B (B:)
    drsrvfdilsninigwnlgntldatgggnsvnaetswgnpkttqeivdtvndrgfnairi
    pvtfanhlgpapeytisadwlarvkevvdyavndgmyiildthhetnywlktdpnneaal
    ceelaaiwkqlaeafkdydeklmfegmneprmagsakewsggtpaerklinamnkafida
    vratggnnadrvliictyghnsdeptlkdleipsdpniavalhtytpyfftyvadgsysv
    wngskknditwqynnikkylidkgipvvitetgaqfkentedivrwigdyvgtldqdgvk
    cfiwdnniyhgngekfgllnrsllkwynddivdayvnha