PDB entry 4w81

View 4w81 on RCSB PDB site
Description: Periplasmically Produced Monomeric Single Domain Antibody (sdAb) C22A/C99V variant against Staphylococcal enterotoxin B (SEB) at pH 8.0
Class: immune system
Keywords: single domain antibody, v-set domain
Deposited on 2014-08-22, released 2014-11-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.195
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single Domain Antibody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4W81 (0-End)
    Domains in SCOPe 2.07: d4w81a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4w81A (A:)
    maevqlvesggglvqagdslrlsatasgrtfsravmgwfrqapgkerefvaaisaapgta
    yyafyadsvrgrfsisadsakntvylqmnslkpedtavyyvaadlkmqvaaymnqrsvdy
    wgqgtqvtvssaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w81A (A:)
    maevqlvesggglvqagdslrlsatasgrtfsravmgwfrqapgkerefvaaisaapgta
    yyafyadsvrgrfsisadsakntvylqmnslkpedtavyyvaadlkmqvaaymnqrsvdy
    wgqgtqvtvss