PDB entry 4w68

View 4w68 on RCSB PDB site
Description: Cytoplasmically Produced Homodimeric Single Domain Antibody (sdAb) C22A/C99V variant against Staphylococcal enterotoxin B (SEB)
Class: immune system
Keywords: beta helical, amyloid-like, misfolded, dimeric, IMMUNE SYSTEM
Deposited on 2014-08-20, released 2014-11-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single Domain Antibody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4W68 (Start-132)
    Domains in SCOPe 2.07: d4w68a_
  • Chain 'B':
    Compound: Single Domain Antibody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4W68 (Start-132)
    Domains in SCOPe 2.07: d4w68b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4w68A (A:)
    gshmevqlvesggglvqagdslrlsatasgrtfsravmgwfrqapgkerefvaaisaapg
    tayyafyadsvrgrfsisadsakntvylqmnslkpedtavyyvaadlkmqvaaymnqrsv
    dywgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w68A (A:)
    mevqlvesggglvqagdslrlsatasgrtfsravmgwfrqapgkerefvaaisaapgtay
    yafyadsvrgrfsisadsakntvylqmnslkpedtavyyvaadlkmqvaaymnqrsvdyw
    gqgtqvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4w68B (B:)
    gshmevqlvesggglvqagdslrlsatasgrtfsravmgwfrqapgkerefvaaisaapg
    tayyafyadsvrgrfsisadsakntvylqmnslkpedtavyyvaadlkmqvaaymnqrsv
    dywgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w68B (B:)
    mevqlvesggglvqagdslrlsatasgrtfsravmgwfrqapgkerefvaaisaapgtay
    yafyadsvrgrfsisadsakntvylqmnslkpedtavyyvaadlkmqvaaymnqrsvdyw
    gqgtqvtvss