PDB entry 4w65

View 4w65 on RCSB PDB site
Description: Crystal Structure of Glycosyl hydrolase family protein from Mycobacterium fortuitum
Class: hydrolase
Keywords: SSGCID, Glycosyl hydrolase family protein, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2014-08-20, released 2014-09-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.154
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycosyl hydrolase family protein
    Species: Mycobacterium fortuitum subsp. fortuitum DSM 46621 [TaxId:1214102]
    Gene: MFORT_18233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4w65a_
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4w65A (A:)
    manldrrkmmmlsglgvmaaalpaphaqalptkpqtppvpvpsapqaavnyvfadefdgp
    agsspntskwtiakaretikdptyweqpgrigqyrddrknafldgkgnlviratkegdty
    ygaklasvweggaghtwearikfncltagawpafwlgtlgegeldivewygngkwpsatt
    vhaksnggewethniavdtawhtwrtqwdangarfwqdytegakpyfevsasqlpdwpfn
    qpgytmfvvlnlavagsggedpsggtypadmlvdyvrvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w65A (A:)
    vnyvfadefdgpagsspntskwtiakaretikdptyweqpgrigqyrddrknafldgkgn
    lviratkegdtyygaklasvweggaghtwearikfncltagawpafwlgtlgegeldive
    wygngkwpsattvhaksnggewethniavdtawhtwrtqwdangarfwqdytegakpyfe
    vsasqlpdwpfnqpgytmfvvlnlavagsggedpsggtypadmlvdyvrvw