PDB entry 4w5k

View 4w5k on RCSB PDB site
Description: Structure of a mitochondrial aspartate aminotransferase from Trypanosoma brucei, K237A mutant
Class: transferase
Keywords: SSGCID, Aspartate aminotransferase, mitochondrial, Trypanosoma brucei, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2014-08-18, released 2014-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate aminotransferase, mitochondrial
    Species: Trypanosoma brucei brucei [TaxId:999953]
    Gene: Tb11.02.2740
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q385Q9 (Start-395)
      • conflict (154)
      • engineered mutation (244)
    Domains in SCOPe 2.07: d4w5ka_
  • Chain 'B':
    Compound: Aspartate aminotransferase, mitochondrial
    Species: Trypanosoma brucei brucei [TaxId:999953]
    Gene: Tb11.02.2740
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q385Q9 (Start-395)
      • conflict (154)
      • engineered mutation (244)
    Domains in SCOPe 2.07: d4w5kb_
  • Heterogens: PLP, MLT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4w5kA (A:)
    mahhhhhhmgkpdpilglgqdfrmdpakrkvnlsigvyrddadqpfvlecvkqatlgtnm
    dyapvtgiasfveeaqklcfgptcaalrdgriascqtlggtgalriggdllnrfvancnr
    iygpdvgypnhesifakagmeltpysyydpatkglnlagmlecldkapegsvilvhacah
    nptgvdpthddwrqvcdvikrrnhipfvdmayqgfatgqldydafvprhlvdmvpnliva
    qsfsanfglyghrcgalhistasaeeakrlvsqlallirpmysnpplygawvvssilkdp
    qltalwkkelkqmssriaevrkrlvselkacgsvhdwshierqvgmmaytgltreqvell
    rseyhiymtlngraavsglnstnveyvsqaihnvtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w5kA (A:)
    glgqdfrmdpakrkvnlsigvyrddadqpfvlecvkqatlgtnmdyapvtgiasfveeaq
    klcfgptcaalrdgriascqtlggtgalriggdllnrfvancnriygpdvgypnhesifa
    kagmeltpysyydpatkglnlagmlecldkapegsvilvhacahnptgvdpthddwrqvc
    dvikrrnhipfvdmayqgfatgqldydafvprhlvdmvpnlivaqsfsanfglyghrcga
    lhistasaeeakrlvsqlallirpmysnpplygawvvssilkdpqltalwkkelkqmssr
    iaevrkrlvselkacgsvhdwshierqvgmmaytgltreqvellrseyhiymtlngraav
    sglnstnveyvsqaihnvtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4w5kB (B:)
    mahhhhhhmgkpdpilglgqdfrmdpakrkvnlsigvyrddadqpfvlecvkqatlgtnm
    dyapvtgiasfveeaqklcfgptcaalrdgriascqtlggtgalriggdllnrfvancnr
    iygpdvgypnhesifakagmeltpysyydpatkglnlagmlecldkapegsvilvhacah
    nptgvdpthddwrqvcdvikrrnhipfvdmayqgfatgqldydafvprhlvdmvpnliva
    qsfsanfglyghrcgalhistasaeeakrlvsqlallirpmysnpplygawvvssilkdp
    qltalwkkelkqmssriaevrkrlvselkacgsvhdwshierqvgmmaytgltreqvell
    rseyhiymtlngraavsglnstnveyvsqaihnvtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w5kB (B:)
    glgqdfrmdpakrkvnlsigvyrddadqpfvlecvkqatlgtnmdyapvtgiasfveeaq
    klcfgptcaalrdgriascqtlggtgalriggdllnrfvancnriygpdvgypnhesifa
    kagmeltpysyydpatkglnlagmlecldkapegsvilvhacahnptgvdpthddwrqvc
    dvikrrnhipfvdmayqgfatgqldydafvprhlvdmvpnlivaqsfsanfglyghrcga
    lhistasaeeakrlvsqlallirpmysnpplygawvvssilkdpqltalwkkelkqmssr
    iaevrkrlvselkacgsvhdwshierqvgmmaytgltreqvellrseyhiymtlngraav
    sglnstnveyvsqaihnvtk