PDB entry 4w4o

View 4w4o on RCSB PDB site
Description: High-resolution crystal structure of Fc bound to its human receptor Fc-gamma-RI
Class: immune system
Keywords: immune complex IgG1 protein-protein complex asymmetry, IMMUNE SYSTEM
Deposited on 2014-08-15, released 2015-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • conflict (220)
    Domains in SCOPe 2.06: d4w4oa1, d4w4oa2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4w4ob1, d4w4ob2
  • Chain 'C':
    Compound: High affinity immunoglobulin gamma Fc receptor I
    Species: Homo sapiens [TaxId:9606]
    Gene: FCGR1A, FCG1, FCGR1, IGFR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12314
      • engineered mutation (9)
      • engineered mutation (22)
      • engineered mutation (47)
      • engineered mutation (53)
      • engineered mutation (55)
      • engineered mutation (61-62)
      • engineered mutation (84)
      • engineered mutation (98)
      • engineered mutation (144)
      • engineered mutation (147)
      • engineered mutation (179)
      • engineered mutation (190-191)
      • engineered mutation (224)
  • Heterogens: NAG, BMA, MAN, FUC, GAL, ZN, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4w4oA (A:)
    htcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgve
    vhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqp
    repqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgs
    fflyskltvdksrwqqgnvfscsvmhealhnhytqkslslapgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w4oA (A:)
    pellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkp
    reeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytl
    ppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysklt
    vdksrwqqgnvfscsvmhealhnhytqkslslapg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4w4oB (B:)
    htcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgve
    vhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqp
    repqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgs
    fflyskltvdksrwqqgnvfscsvmhealhnhytqkslslapgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w4oB (B:)
    lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpree
    qynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlpps
    rdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdk
    srwqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'C':
    No sequence available.