PDB entry 4w4l

View 4w4l on RCSB PDB site
Description: Crystal structure of EspG5 in complex with PE25 and PPE41 from the ESX-5 type VII secretion system of M. tuberculosis
Class: protein transport
Keywords: ternary complex, signal recognition, virulence factor, protein secretion, PROTEIN TRANSPORT
Deposited on 2014-08-14, released 2014-10-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PE family protein PE25
    Species: Mycobacterium tuberculosis [TaxId:652616]
    Gene: PE25, ERDMAN_2675, Q643_02517
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4w4la_
  • Chain 'B':
    Compound: PPE family protein PPE41
    Species: Mycobacterium tuberculosis [TaxId:652616]
    Gene: PPE41, ERDMAN_2674, Q643_02516
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4w4lb_
  • Chain 'C':
    Compound: EspG5
    Species: Mycobacterium tuberculosis [TaxId:652616]
    Gene: ERDMAN_1984, Q643_01851
    Database cross-references and differences (RAF-indexed):
    • Uniprot H8F3E2 (Start-299)
      • expression tag (300-301)
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4w4lA (A:)
    msfvitnpealtvaatevrrirdraiqsdaqvapmttavrppaadlvsekaatflveyar
    kyrqtiaaaavvleefahalttgadkyataeadniktfssgethhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w4lA (A:)
    npealtvaatevrrirdraiqsdaqvapmttavrppaadlvsekaatflveyarkyrqti
    aaaavvleefahalttgadkyata
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4w4lB (B:)
    mhfeayppevnsaniyagpgpdsmlaaarawrsldvemtavqrsfnrtllslmdawagpv
    vmqlmeaakpfvrwltdlcvqlseverqiheivrayewahhdmvplaqiynnraerqili
    dnnalgqftaqiadldqeyddfwdedgevmrdyrlrvsdalskltpwkapppia
    

  • Chain 'C':
    No sequence available.