PDB entry 4w4l
View 4w4l on RCSB PDB site
Description: Crystal structure of EspG5 in complex with PE25 and PPE41 from the ESX-5 type VII secretion system of M. tuberculosis
Class: protein transport
Keywords: ternary complex, signal recognition, virulence factor, protein secretion, PROTEIN TRANSPORT
Deposited on
2014-08-14, released
2014-10-01
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-12-11, with a file datestamp of
2019-12-06.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: PE family protein PE25
Species: Mycobacterium tuberculosis [TaxId:652616]
Gene: PE25, ERDMAN_2675, Q643_02517
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4w4la_ - Chain 'B':
Compound: PPE family protein PPE41
Species: Mycobacterium tuberculosis [TaxId:652616]
Gene: PPE41, ERDMAN_2674, Q643_02516
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4w4lb_ - Chain 'C':
Compound: EspG5
Species: Mycobacterium tuberculosis [TaxId:652616]
Gene: ERDMAN_1984, Q643_01851
Database cross-references and differences (RAF-indexed):
- Heterogens: EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4w4lA (A:)
msfvitnpealtvaatevrrirdraiqsdaqvapmttavrppaadlvsekaatflveyar
kyrqtiaaaavvleefahalttgadkyataeadniktfssgethhhhhh
Sequence, based on observed residues (ATOM records): (download)
>4w4lA (A:)
npealtvaatevrrirdraiqsdaqvapmttavrppaadlvsekaatflveyarkyrqti
aaaavvleefahalttgadkyata
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4w4lB (B:)
mhfeayppevnsaniyagpgpdsmlaaarawrsldvemtavqrsfnrtllslmdawagpv
vmqlmeaakpfvrwltdlcvqlseverqiheivrayewahhdmvplaqiynnraerqili
dnnalgqftaqiadldqeyddfwdedgevmrdyrlrvsdalskltpwkapppia
- Chain 'C':
No sequence available.