PDB entry 4v2n

View 4v2n on RCSB PDB site
Description: Crystallographic structure of thioredoxin from Litopenaeus vannamei: Radiation damage effect at 85 MGy, focused in disulfide bonds
Class: oxidoreductase
Keywords: oxidoreductase, litopenaeus vannamei, disulfide bond
Deposited on 2014-10-10, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.1816
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Litopenaeus vannamei [TaxId:6689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PWB9 (0-104)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d4v2na_
  • Chain 'B':
    Compound: thioredoxin
    Species: Litopenaeus vannamei [TaxId:6689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PWB9 (0-104)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d4v2nb_
  • Heterogens: ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4v2nA (A:)
    mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvd
    ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4v2nB (B:)
    mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvd
    ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk