PDB entry 4v2g

View 4v2g on RCSB PDB site
Description: Tetracycline repressor TetR(D) bound to chlortetracycline and iso- chlortetracycline
Class: transcription
Keywords: transcription, repressor, antibiotic resistance, tetr
Deposited on 2014-10-09, released 2014-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.18203
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4v2ga1, d4v2ga2, d4v2ga3
  • Chain 'B':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4v2gb1, d4v2gb2, d4v2gb3
  • Heterogens: ITC, CTC, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4v2gA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4v2gB (B:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v2gB (B:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtanlppllrealqimdsddgeqaflhgles
    lirgfevqltallqiv