PDB entry 4v1p

View 4v1p on RCSB PDB site
Description: BTN3 Structure
Class: immune system
Keywords: immune system, immune signalling
Deposited on 2014-09-30, released 2015-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Butyrophilin subfamily 3 member A1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00481 (0-187)
      • conflict (184)
    Domains in SCOPe 2.08: d4v1pa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4v1pA (A:)
    rhsaynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhycv
    lgcesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtl
    teprtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltle
    ptalsicp