PDB entry 4uzw

View 4uzw on RCSB PDB site
Description: High-resolution NMR structures of the domains of Saccharomyces cerevisiae Tho1
Class: RNA binding protein
Keywords: RNA binding protein, sap
Deposited on 2014-09-09, released 2014-12-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tho1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40040 (0-49)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d4uzwa1, d4uzwa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4uzwA (A:)
sadyssltvvqlkdlltkrnlsvgglknelvqrlikddeeskgesevspq