PDB entry 4uyp

View 4uyp on RCSB PDB site
Description: High resolution structure of the third cohesin ScaC in complex with the ScaB dockerin with a mutation in the N-terminal helix (IN to SI) from Acetivibrio cellulolyticus displaying a type I interaction.
Class: cell adhesion/protein binding
Keywords: cell adhesion-protein binding complex, cellulosome, type 1 cohesin-dockerin intereactions, adaptor scaffoldin scab, anchoring scaffolding scac
Deposited on 2014-09-02, released 2015-04-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulosomal scaffoldin anchoring protein c
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WYN2 (5-142)
      • expression tag (0)
      • expression tag (143)
    Domains in SCOPe 2.05: d4uypa_
  • Chain 'B':
    Compound: Cellulosomal scaffoldin adaptor protein B
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WYN3 (0-End)
      • engineered mutation (14-15)
  • Chain 'C':
    Compound: cellulosomal scaffoldin anchoring protein c
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WYN2 (5-142)
      • expression tag (0)
      • expression tag (143-145)
    Domains in SCOPe 2.05: d4uypc_
  • Chain 'D':
    Compound: Cellulosomal scaffoldin adaptor protein B
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WYN3 (0-End)
      • engineered mutation (14-15)
  • Heterogens: SO4, EPE, MPD, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uypA (A:)
    mlqvdigstsgkagsvvsvpitftnvpksgiyalsfrtnfdpqkvtvasidagslienas
    dfttyynnengfasmtfeapvdrariidsdgvfatinfkvsdsakvgelynittnsayts
    fyysgtdeiknvvyndgkievialehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uypA (A:)
    mlqvdigstsgkagsvvsvpitftnvpksgiyalsfrtnfdpqkvtvasidagslienas
    dfttyynnengfasmtfeapvdrariidsdgvfatinfkvsdsakvgelynittnsayts
    fyysgtdeiknvvyndgkievial
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4uypC (C:)
    mlqvdigstsgkagsvvsvpitftnvpksgiyalsfrtnfdpqkvtvasidagslienas
    dfttyynnengfasmtfeapvdrariidsdgvfatinfkvsdsakvgelynittnsayts
    fyysgtdeiknvvyndgkievialehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uypC (C:)
    mlqvdigstsgkagsvvsvpitftnvpksgiyalsfrtnfdpqkvtvasidagslienas
    dfttyynnengfasmtfeapvdrariidsdgvfatinfkvsdsakvgelynittnsayts
    fyysgtdeiknvvyndgkievialeh
    

  • Chain 'D':
    No sequence available.