PDB entry 4uy2

View 4uy2 on RCSB PDB site
Description: Crystal structure of the complex of the extracellular domain of human alpha9 nAChR with alpha-bungarotoxin.
Class: toxin-binding protein/toxin
Keywords: toxin-binding protein-toxin complex, ligand binding domain, cys-loop receptor
Deposited on 2014-08-28, released 2014-10-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2617
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuronal acetylcholine receptor subunit alpha-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uy2a_
  • Chain 'B':
    Compound: neuronal acetylcholine receptor subunit alpha-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uy2b_
  • Chain 'C':
    Compound: alpha-bungarotoxin isoform v31
    Species: Bungarus multicinctus [TaxId:8616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uy2c_
  • Chain 'D':
    Compound: alpha-bungarotoxin isoform v31
    Species: Bungarus multicinctus [TaxId:8616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uy2d_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uy2A (A:)
    adgkyaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirq
    iwhdayltwdrdqydgldsiripsdlvwrpdivlynkaddessepvntnvvlrydglitw
    dapaitksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewev
    hgmpavknvisygccsepypdvtftlllkrrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uy2A (A:)
    yaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirqiwhd
    ayltwdrdqydgldsiripsdlvwrpdivlynkadpvntnvvlrydglitwdapaitkss
    cvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewevhgmpavknv
    isygccsepypdvtftlllkrrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uy2B (B:)
    adgkyaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirq
    iwhdayltwdrdqydgldsiripsdlvwrpdivlynkaddessepvntnvvlrydglitw
    dapaitksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewev
    hgmpavknvisygccsepypdvtftlllkrrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uy2B (B:)
    yaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirqiwhd
    ayltwdrdqydgldsiripsdlvwrpdivlynkadpvntnvvlrydglitwdapaitkss
    cvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewevhgmpavknv
    isygccsepypdvtftlllkrrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4uy2C (C:)
    ivchttatspisavtcppgenlcyrkmwcdvfcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnphpkqrpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uy2C (C:)
    ivchttatspisavtcppgenlcyrkmwcdvfcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnphpkqrp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4uy2D (D:)
    ivchttatspisavtcppgenlcyrkmwcdvfcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnphpkqrpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uy2D (D:)
    ivchttatspisavtcppgenlcyrkmwcdvfcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnphpkqrp