PDB entry 4uxu

View 4uxu on RCSB PDB site
Description: Crystal Structure of the Extracellular Domain of the Human Alpha9 Nicotinic Acetylcholine Receptor In Complex with Methyllycaconitine
Class: transport protein
Keywords: transport protein, transport, neuronal type nachr, extracellular domain, methyllycaconitine, antagonist
Deposited on 2014-08-27, released 2014-10-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.2112
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuronal acetylcholine receptor subunit alpha-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uxua_
  • Chain 'B':
    Compound: neuronal acetylcholine receptor subunit alpha-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uxub_
  • Heterogens: MLK, EPE, EDO, NA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uxuA (A:)
    adgkyaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirq
    iwhdayltwdrdqydgldsiripsdlvwrpdivlynkaddessepvntnvvlrydglitw
    dapaitksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewev
    hgmpavknvisygccsepypdvtftlllkrrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxuA (A:)
    gkyaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirqiw
    hdayltwdrdqydgldsiripsdlvwrpdivlynkaddessepvntnvvlrydglitwda
    paitksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewevhg
    mpavknvisygccsepypdvtftlllkrrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uxuB (B:)
    adgkyaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirq
    iwhdayltwdrdqydgldsiripsdlvwrpdivlynkaddessepvntnvvlrydglitw
    dapaitksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewev
    hgmpavknvisygccsepypdvtftlllkrrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxuB (B:)
    gkyaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirqiw
    hdayltwdrdqydgldsiripsdlvwrpdivlynkaddessepvntnvvlrydglitwda
    paitksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewevhg
    mpavknvisygccsepypdvtftlllkrrs