PDB entry 4uxq

View 4uxq on RCSB PDB site
Description: FGFR4 in complex with Ponatinib
Class: transferase
Keywords: transferase, kinase dfg-out fgfr inhibitor complex
Deposited on 2014-08-27, released 2014-12-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.2048
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22455
      • engineered mutation (32)
    Domains in SCOPe 2.04: d4uxqa_
  • Heterogens: SO4, 0LI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uxqA (A:)
    gsaglvsldlpldplwefprdrlvlgkplgegafgqvvraeafgmdparpdqastvavkm
    lkdnasdkdladlvsemevmkligrhkniinllgvctqegplyvivecaakgnlreflra
    rrppgpdlspdgprssegplsfpvlvscayqvargmqylesrkcihrdlaarnvlvtedn
    vmkiadfglargvhhidyykktsngrlpvkwmapealfdrvythqsdvwsfgillweift
    lggspypgipveelfsllreghrmdrpphcppelyglmrecwhaapsqrptfkqlveald
    kvllavsee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxqA (A:)
    ldlpldplwefprdrlvlgkplgegafgqvvraeafgmdparpdqastvavkmlkdnasd
    kdladlvsemevmkligrhkniinllgvctqegplyvivecaakgnlreflrarrppgpl
    sfpvlvscayqvargmqylesrkcihrdlaarnvlvtednvmkiadfglargvhhidyyk
    ktsngrlpvkwmapealfdrvythqsdvwsfgillweiftlggspypgipveelfsllre
    ghrmdrpphcppelyglmrecwhaapsqrptfkqlvealdkvllav