PDB entry 4uxm

View 4uxm on RCSB PDB site
Description: Crystal Structure of Struthiocalcin-1, a different crystal form.
Class: structural protein
Keywords: structural protein
Deposited on 2014-08-26, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: struthiocalcin-1
    Species: STRUTHIO CAMELUS [TaxId:8801]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uxma_
  • Heterogens: BE7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uxmA (A:)
    dkcpkgwldfrgncygyfryelpwkraeawcrsiragahlasihtseehraiakfisqyh
    hgeeeedvwiglfrwnsvwawidgskkhysalddddypkgkhcavldessgflswdndsc
    gernafickcta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxmA (A:)
    kcpkgwldfrgncygyfryelpwkraeawcrsiragahlasihtseehraiakfisqyhh
    geeeedvwiglfrwnsvwawidgskkhysalddddypkgkhcavldessgflswdndscg
    ernafickcta