PDB entry 4uxa

View 4uxa on RCSB PDB site
Description: Improved variant of (R)-selective manganese-dependent hydroxynitrile lyase from bacteria
Class: lyase
Keywords: lyase, manganese-dependant
Deposited on 2014-08-21, released 2015-01-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.1835
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxaa_
  • Chain 'B':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxab_
  • Chain 'C':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxac_
  • Chain 'D':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxad_
  • Chain 'E':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxae_
  • Chain 'F':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxaf_
  • Chain 'G':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxag_
  • Chain 'H':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxah_
  • Chain 'I':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxai_
  • Chain 'J':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxaj_
  • Chain 'K':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxak_
  • Chain 'L':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxal_
  • Chain 'M':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxam_
  • Chain 'N':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxan_
  • Chain 'O':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxao_
  • Chain 'P':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxap_
  • Chain 'Q':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxaq_
  • Chain 'R':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxar_
  • Chain 'S':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxas_
  • Chain 'T':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:940615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E8WYN5 (0-130)
      • engineered mutation (39)
      • engineered mutation (41)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d4uxat_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaA (A:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaB (B:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaC (C:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaD (D:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaE (E:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaF (F:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaG (G:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaH (H:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaI (I:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaJ (J:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaK (K:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaL (L:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaM (M:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaN (N:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaO (O:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaP (P:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaQ (Q:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaR (R:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaS (S:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uxaT (T:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
    mehvtdeqyrr