PDB entry 4ux6

View 4ux6 on RCSB PDB site
Description: The discovery of novel, potent and highly selective inhibitors of inducible nitric oxide synthase (iNOS)
Class: oxidoreductase
Keywords: drug design, oxidoreductase
Deposited on 2014-08-19, released 2014-10-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.23
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ux6b_
  • Heterogens: HEM, H4B, YWO

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ux6B (B:)
    sclgsimnpksltrgprdkptpleellphaiefinqyygsfkeakieehlarleavtkei
    ettgtyqltldelifatkmawrnaprcigriqwsnlqvfdarncstaqemfqhicrhily
    atnngnirsaitvfpqrsdgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidl
    gwkprygrfdvlplvlqadgqdpevfeippdlvlevtmehpkyewfqelglkwyalpava
    nmllevgglefpacpfngwymgteigvrdfcdtqrynileevgrrmglethtlaslwkdr
    avteinvavlhsfqkqnvtimdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsit
    pvfhqemlnyvlspfyyyqiepwkthiwq