PDB entry 4uww

View 4uww on RCSB PDB site
Description: Crystallographic Structure of the Intramineral Protein Struthicalcin from Struthio camelus Eggshell
Class: structural protein
Keywords: structural protein
Deposited on 2014-08-14, released 2015-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: struthiocalcin-1
    Species: STRUTHIO CAMELUS [TaxId:8801]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uwwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uwwA (A:)
    dkcpkgwldfrgncygyfryelpwkraeawcrsiragahlasihtseehraiakfisqyh
    hgeeeedvwiglfrwnsvwawidgskkhysalddddypkgkhcavldessgflswdndsc
    gernafickcta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uwwA (A:)
    dkcpkgwldfrgncygyfryelpwkraeawcrsiragahlasihtseehraiakfisqyh
    hgeeeedvwiglfrwnsvwawidgskkhysalddypkgkhcavldessgflswdndscge
    rnafickcta