PDB entry 4uw3

View 4uw3 on RCSB PDB site
Description: Human galectin-7 in complex with a galactose based dendron D1.
Class: sugar binding protein
Keywords: sugar binding protein, lectin, galectin-7, dendrimers, multivalency, carbohydrate binding
Deposited on 2014-08-08, released 2014-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human galectin-7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uw3a_
  • Chain 'B':
    Compound: human galectin-7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uw3b_
  • Heterogens: 50G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uw3A (A:)
    msnvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsev
    vfnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvr
    lvevggdvqldsvrif
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uw3A (A:)
    nvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvf
    nskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlv
    evggdvqldsvrif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uw3B (B:)
    msnvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsev
    vfnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvr
    lvevggdvqldsvrif
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uw3B (B:)
    phksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfns
    keqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlvev
    ggdvqldsvrif