PDB entry 4uvh

View 4uvh on RCSB PDB site
Description: Discovery of pyrimidine isoxazoles InhA in complex with compound 10
Class: oxidoreductase
Keywords: oxidoreductase, inha, acp enoyl reductase, fblg, pyrimidine isoxazole
Deposited on 2014-08-05, released 2015-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uvha_
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uvhb_
  • Chain 'C':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uvhc_
  • Chain 'D':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uvhd_
  • Heterogens: NAD, UUD, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uvhA (A:)
    mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapl
    leldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgi
    hisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareag
    kygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvak
    tvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uvhA (A:)
    tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
    isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
    ygvrsnlvaagpirtgalgeeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdw
    lpattgdiiyadggahtqll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uvhB (B:)
    mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapl
    leldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgi
    hisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareag
    kygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvak
    tvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uvhB (B:)
    tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmgnpffdapyadvskgihi
    saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
    gvrsnlvaagpirtleeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdwlpat
    tgdiiyadggahtqll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4uvhC (C:)
    mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapl
    leldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgi
    hisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareag
    kygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvak
    tvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uvhC (C:)
    tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
    isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
    ygvrsnlvaagpirtqlleegwdqrapigwnmkdatpvaktvcallsdwlpattgdiiya
    dggahtqll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4uvhD (D:)
    mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapl
    leldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgi
    hisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareag
    kygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvak
    tvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uvhD (D:)
    tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdliqritdrlpakaplleld
    vqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihisa
    ysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagkygv
    rsnlvaagpirtlgalgeeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdwlp
    attgdiiyadggahtqll