PDB entry 4uut

View 4uut on RCSB PDB site
Description: Cristal structure of the Ultrabithorax protein
Class: transcription
Keywords: transcription, ubx, homeotic protein, transcription factor
Deposited on 2014-07-31, released 2015-02-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-02-18, with a file datestamp of 2015-02-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2192
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homeotic protein ultrabithorax
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4uuta_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4uutA (A:)
mqasnhtfypwmaiagtnglrrrgrqtytryqtlelekefhtnhyltrrrriemahalcl
terqikiwfqnrrmklkkeiqaikelneqekqa

    Sequence, based on observed residues (ATOM records): (download) 
    >4uutA (A:)
tytryqtlelekefhtnhyltrrrriemahalclterqikiwfqnrrmklkkeiqaikel
neqekqa