PDB entry 4uuo

View 4uuo on RCSB PDB site
Description: Apo trichomonas vaginalis malate dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2014-07-29, released 2015-08-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytosolic malate dehydrogenase
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27819 (Start-331)
      • expression tag (332-335)
    Domains in SCOPe 2.05: d4uuoa1, d4uuoa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uuoA (A:)
    mepihilitgaagqigyaltfriakgdlcgdrkvvlhlleipfgmkalegcvmelqdcaf
    pnvagivwtdkveeafkgvdvaflvgsfprkdgmdrsdllaknggiftvqgkalndyakp
    tvkvlvvgnpantncliaqasapklqnknwcamtrldhnrmvgalaakfgvtpekihkvc
    iwgnhsntqvpdtthatvdlpegtvkvadklpkeylegefaqmiatrggavikmrgassa
    asaanaaltcvkdwlygtaegdfvsmaipvpdnepygikqgtifsfpvtvskdgevhvve
    glelndwvkgrleatekeligeketawkvlgllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uuoA (A:)
    epihilitgaagqigyaltfriakgdlcgdrkvvlhlleipfgmkalegcvmelqdcafp
    nvagivwtdkveeafkgvdvaflvgsfprkdgmdrsdllaknggiftvqgkalndyakpt
    vkvlvvgnpantncliaqasapklqnknwcamtrldhnrmvgalaakfgvtpekihkvci
    wgnhsntqvpdtthatvdtvkvadklpkeylegefaqmiatrggavikmrgassaasaan
    aaltcvkdwlygtdfvsmaipvpdnepygikqgtifsfpvtvskdgevhvveglelndwv
    kgrleatekeligeketawkvlgllehh