PDB entry 4uuj

View 4uuj on RCSB PDB site
Description: potassium channel kcsa-fab with tetrahexylammonium
Class: immune system/metal transport
Keywords: immune system-metal transport complex, quaternary ammonium, protein-antibody fab complex, ionic channel, ion transport, potassium channel
Deposited on 2014-07-29, released 2014-08-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19436
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UUJ (0-218)
    Domains in SCOPe 2.07: d4uuja1, d4uuja2, d4uuja3
  • Chain 'B':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UUJ (0-211)
    Domains in SCOPe 2.07: d4uujb1, d4uujb2
  • Chain 'C':
    Compound: voltage-gated potassium channel kcsa
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (8-110)
      • expression tag (0-7)
      • conflict (76)
    Domains in SCOPe 2.07: d4uujc1, d4uujc2
  • Heterogens: F09, IND, K, DGA, CO, XA7, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uujA (A:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uujB (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uujC (C:)
    aavalllgsalhwraagaatvllvivllagsylavlaergapgaqlitypralwwsveta
    ttvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh