PDB entry 4uuc

View 4uuc on RCSB PDB site
Description: Crystal structure of human ASB11 ankyrin repeat domain
Class: signaling protein
Keywords: signaling protein
Deposited on 2014-07-25, released 2014-08-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1635
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ankyrin repeat and socs box protein 11
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4uuca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uucA (A:)
    smadrsplheaaaqgrllalktliaqgvnvnlvtinrvsslheaclgghvacakalleng
    ahvngvtvhgatplfnaccsgsaacvnvllefgakaqlevhlaspiheavkrghrecmei
    llannvnidhevpqlgtplyvactyqrvdcvkkllelgasvdhgqwldtplhaaarqsnv
    evihlltdyganlkrrnaqgksaldlaapkssveqalllregppal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uucA (A:)
    rsplheaaaqgrllalktliaqgvnvnlvtinrvsslheaclgghvacakallengahvn
    gvtvhgatplfnaccsgsaacvnvllefgakaqlevhlaspiheavkrghrecmeillan
    nvnidhevpqlgtplyvactyqrvdcvkkllelgasvdhgqwldtplhaaarqsnvevih
    lltdyganlkrrnaqgksaldlaapkssveqalllregppa