PDB entry 4uu9

View 4uu9 on RCSB PDB site
Description: Crystal structure of the human c5a in complex with MEDI7814 a neutralising antibody
Class: immune system
Keywords: immune system, fv, complement system
Deposited on 2014-07-25, released 2015-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: medi7814
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UU9 (0-122)
    Domains in SCOPe 2.07: d4uu9a_
  • Chain 'B':
    Compound: medi7814
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UU9 (Start-110)
    Domains in SCOPe 2.07: d4uu9b_
  • Chain 'C':
    Compound: Complement C5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01031 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d4uu9c1, d4uu9c2
  • Chain 'D':
    Compound: Complement C5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01031 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d4uu9d1, d4uu9d2
  • Chain 'H':
    Compound: medi7814
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UU9 (0-122)
    Domains in SCOPe 2.07: d4uu9h_
  • Chain 'L':
    Compound: medi7814
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UU9 (0-End)
    Domains in SCOPe 2.07: d4uu9l_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uu9A (A:)
    evqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycardddyeewpwyygmdvwgqgtmv
    tvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uu9B (B:)
    qsaltqpasvsgspgqsitisctgtssdiggskyvswyqqhpgkapkliifdvnrrpsgl
    snrfsasksgntasltisglqaedeadyyctsyhptktilfgggtkltvla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uu9B (B:)
    altqpasvsgspgqsitisctgtssdiggskyvswyqqhpgkapkliifdvnrrpsglsn
    rfsasksgntasltisglqaedeadyyctsyhptktilfgggtkltvla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4uu9C (C:)
    stlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvas
    qlranishkdmqlgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uu9C (C:)
    stlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvas
    qlran
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4uu9D (D:)
    stlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvas
    qlranishkdmqlgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uu9D (D:)
    stlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvas
    qlrani
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uu9H (H:)
    evqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycardddyeewpwyygmdvwgqgtmv
    tvs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4uu9L (L:)
    qsaltqpasvsgspgqsitisctgtssdiggskyvswyqqhpgkapkliifdvnrrpsgl
    snrfsasksgntasltisglqaedeadyyctsyhptktilfgggtkltvla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uu9L (L:)
    qsaltqpasvsgspgqsitisctgtssdiggskyvswyqqhpgkapkliifdvnrrpsgl
    snrfsasksgntasltisglqaedeadyyctsyhptktilfgggtkltvl