PDB entry 4utu

View 4utu on RCSB PDB site
Description: Structural and biochemical characterization of the N- acetylmannosamine-6-phosphate 2-epimerase from Clostridium perfringens
Class: isomerase
Keywords: isomerase, sugar 2-epimerase, sialic acid, sugar phosphate, enzyme mechanism, carbohydrate, mutagenesis, 1h nmr spectroscopy
Deposited on 2014-07-23, released 2014-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.14062
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetylmannosamine-6-phosphate 2-epimerase
    Species: CLOSTRIDIUM PERFRINGENS STR. 13 [TaxId:195102]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8XNZ3 (9-228)
      • expression tag (0-8)
      • conflict (74)
    Domains in SCOPe 2.06: d4utua1, d4utua2
  • Chain 'B':
    Compound: N-acetylmannosamine-6-phosphate 2-epimerase
    Species: CLOSTRIDIUM PERFRINGENS STR. 13 [TaxId:195102]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8XNZ3 (9-228)
      • expression tag (0-8)
      • conflict (74)
    Domains in SCOPe 2.06: d4utub1, d4utub2
  • Heterogens: LRY, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4utuA (A:)
gsshhhhhhmldvvkgnlivscqalsdeplhssfimgrmaiaakqggaaairaqgvndin
eikevtklpiigiiarnyddseiyitptmkevdellktdcemialdatkrkrpngenvkd
lvdaihakgrlamadistleegieaeklgfdcvsttlsgytpyskqsnsvdfelleelvk
tvkipvicegrintpeelkkaldlgaysavvggaitrpqqitkrftdil

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4utuB (B:)
gsshhhhhhmldvvkgnlivscqalsdeplhssfimgrmaiaakqggaaairaqgvndin
eikevtklpiigiiarnyddseiyitptmkevdellktdcemialdatkrkrpngenvkd
lvdaihakgrlamadistleegieaeklgfdcvsttlsgytpyskqsnsvdfelleelvk
tvkipvicegrintpeelkkaldlgaysavvggaitrpqqitkrftdil