PDB entry 4uts

View 4uts on RCSB PDB site
Description: Room temperature crystal structure of the fast switching M159T mutant of fluorescent protein Dronpa
Class: fluorescent protein
Keywords: fluorescent protein, photoswitching, photochromic
Deposited on 2014-07-22, released 2015-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-215)
      • chromophore (61)
      • engineered mutation (157)
    Domains in SCOPe 2.05: d4utsa_
  • Chain 'B':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-215)
      • chromophore (61)
      • engineered mutation (157)
    Domains in SCOPe 2.05: d4utsb_
  • Chain 'C':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-215)
      • chromophore (61)
      • engineered mutation (157)
    Domains in SCOPe 2.05: d4utsc_
  • Chain 'D':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-215)
      • chromophore (61)
      • engineered mutation (157)
    Domains in SCOPe 2.05: d4utsd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4utsA (A:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvntalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4utsB (B:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvntalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4utsC (C:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvntalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4utsD (D:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvntalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs