PDB entry 4usa

View 4usa on RCSB PDB site
Description: Aldehyde Oxidoreductase from Desulfovibrio gigas (MOP), soaked with trans-cinnamaldehyde
Class: oxidoreductase
Keywords: oxidoreductase, aldehyde, oxidation, molybdenum, pi stacking
Deposited on 2014-07-03, released 2014-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.13 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde oxidoreductase
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4usaa1, d4usaa2, d4usaa3, d4usaa4
  • Heterogens: FES, IPA, BCT, MG, CL, PCD, HCI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4usaA (A:)
    miqkvitvngieqnlfvdaeallsdvlrqqlgltgvkvgceqgqcgacsvildgkvvrac
    vtkmkrvadgaqittiegvgqpenlhplqkawvlhggaqcgfcspgfivsakglldtnad
    psredvrdwfqkhrnacrctgykplvdavmdaaavingkkpetdlefkmpadgriwgsky
    prptavakvtgtldygadlglkmpagtlhlamvqakvshanikgidtsealtmpgvhsvi
    thkdvkgknritglitfptnkgdgwdrpilcdekvfqygdcialvcadseanaraaaekv
    kvdleelpaymsgpaaaaedaieihpgtpnvyfeqpivkgedtgpifasadvtvegdfyv
    grqphmpiepdvafaymgddgkcyihsksigvhlhlymiapgvglepdqlvlvanpmggt
    fgykfsptsealvavaamatgrpvhlrynyqqqqqytgkrspwemnvkfaakkdgtllam
    esdwlvdhgpysefgdlltlrgaqfigagynipnirglgrtvatnhvwgsafrgygapqs
    mfaseclmdmlaeklgmdplelryknayrpgdtnptgqepevfslpdmidqlrpkyqaal
    ekaqkestathkkgvgisigvygsgldgpdaseawaelnadgtitvhtawedhgqgadig
    cvgtahealrpmgvapekikftwpntattpnsgpsggsrqqvmtgnairvacenllkace
    kpgggyytydelkaadkptkitgnwtasgathcdavtglgkpfvvymygvfmaevtvdva
    tgqttvdgmtlmadlgslcnqlatdgqiygglaqgiglalsedfedikkhatlvgagfpf
    ikqipdkldivyvnhprpdgpfgasgvgelpltsphaaiinaiksatgvriyrlpaypek
    vlealka