PDB entry 4urk

View 4urk on RCSB PDB site
Description: PI3Kg in complex with AZD6482
Class: transferase
Keywords: transferase, lipid kinase
Deposited on 2014-06-30, released 2014-10-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.2535
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4urka1, d4urka2, d4urka3, d4urka4
  • Heterogens: A82

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4urkA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4urkA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmdfvlrvcgrde
    ylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeecdrkfrvkirgidipvl
    prntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqi
    ycqllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisilldnr
    aempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiv
    aktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlv
    qavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgc
    gtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfr
    vpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmli
    lqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkd
    evlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhid
    fghilkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmm
    lmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlv