PDB entry 4ure

View 4ure on RCSB PDB site
Description: Molecular Genetic and Crystal Structural Analysis of 1-(4- Hydroxyphenyl)-Ethanol Dehydrogenase from Aromatoleum aromaticum EbN1
Class: oxidoreductase
Keywords: oxidoreductase, short chain dehydrogenase, aromatic compounds, anaerobic degradation, alcohol dehydrogenase, molecular genetics, stereochemistry
Deposited on 2014-06-28, released 2015-07-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-08, with a file datestamp of 2015-07-02.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclohexanol dehydrogenase
    Species: AROMATOLEUM AROMATICUM EBN1 [TaxId:76114]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4urea_
  • Chain 'B':
    Compound: cyclohexanol dehydrogenase
    Species: AROMATOLEUM AROMATICUM EBN1 [TaxId:76114]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ureb_
  • Heterogens: SO4, MG, 1PS, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ureA (A:)
    mllegktalvtgagngigrtialtyaaeganvvvsdisdewgretlaliegkggkavfqh
    adtahpedhdeliaaakrafgrldiacnnagisgeftptaettdaqwqrviginlsgvfy
    gvraqiramletgggaivnissiagqigiegitpytaakhgvvgltktvaweygskgiri
    nsvgpafinttlvqnvpletrrqleqmhalrrlgeteevanlvawlssdkasfvtgsyya
    vdggylar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ureB (B:)
    mllegktalvtgagngigrtialtyaaeganvvvsdisdewgretlaliegkggkavfqh
    adtahpedhdeliaaakrafgrldiacnnagisgeftptaettdaqwqrviginlsgvfy
    gvraqiramletgggaivnissiagqigiegitpytaakhgvvgltktvaweygskgiri
    nsvgpafinttlvqnvpletrrqleqmhalrrlgeteevanlvawlssdkasfvtgsyya
    vdggylar