PDB entry 4uqt

View 4uqt on RCSB PDB site
Description: RRM-peptide structure in RES complex
Class: translation
Keywords: translation
Deposited on 2014-06-25, released 2014-09-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: U2 snRNP component IST3
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40565 (4-92)
  Domains in SCOPe 2.08: d4uqta_
• Chain 'B':
  Compound: Pre-mRNA-splicing factor CWC26
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46947 (4-38)

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4uqtA (A:)
  gamgneykdnayiyignlnreltegdiltvfseygvpvdvilsrdentgesqgfaylkye
  dqrstilavdnlngfkiggralkidhtfyrpkr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4uqtA (A:)
  neykdnayiyignlnreltegdiltvfseygvpvdvilsrdentgesqgfaylkyedqrs
  tilavdnlngfkiggralkidhtfyrpkr
  

  
  
• Chain 'B':
  No sequence available.