PDB entry 4upj

View 4upj on RCSB PDB site
Description: human immunodeficiency virus type 2 protease mutant with lys 57 replaced by leu (k57l) complex with u097410 [4-hydroxy-3-[1-[3- [[[[(tert-butyloxycarbonyl) aminomethyl]carbonyl]amino]phenyl]propyl]coumarin
Deposited on 1996-03-04, released 1996-10-14
The last revision prior to the SCOP 1.65 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d4upja_
  • Chain 'B':
    Domains in SCOP 1.65: d4upjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4upjA (A:)
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4upjB (B:)
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl