PDB entry 4uov

View 4uov on RCSB PDB site
Description: The structure of a tetrameric alpha-carbonic anhydrase from Thermovibrio ammonificans reveals a core formed around intermolecular disulfides, which contribute to its thermostability.
Class: lyase
Keywords: lyase, carbonic anhydrase, thermophilic, acetazolamide, carbon dioxide capture, thermal stability.
Deposited on 2014-06-10, released 2014-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.17341
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonate dehydratase
    Species: THERMOVIBRIO AMMONIFICANS [TaxId:228745]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uova_
  • Chain 'B':
    Compound: Carbonate dehydratase
    Species: THERMOVIBRIO AMMONIFICANS [TaxId:228745]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uovb_
  • Chain 'C':
    Compound: Carbonate dehydratase
    Species: THERMOVIBRIO AMMONIFICANS [TaxId:228745]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uovc_
  • Chain 'D':
    Compound: Carbonate dehydratase
    Species: THERMOVIBRIO AMMONIFICANS [TaxId:228745]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uovd_
  • Chain 'E':
    Compound: Carbonate dehydratase
    Species: THERMOVIBRIO AMMONIFICANS [TaxId:228745]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uove_
  • Chain 'F':
    Compound: Carbonate dehydratase
    Species: THERMOVIBRIO AMMONIFICANS [TaxId:228745]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uovf_
  • Heterogens: ZN, AZM, PE3, B3P, SO4, CL, PEG, TLA, PGE, PG5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uovA (A:)
    mkrvlvtlgavaalatgavagggahwgysgsigpehwgdlspeylmckigknqspidins
    adavkaclapvsvyyvsdakyvvnnghtikvvmggrgyvvvdgkrfylkqfhfhapseht
    vngkhypfeahfvhldkngnitvlgvffkvgkenpelekvwrvmpeepgqkrhltaridp
    ekllpenrdyyrysgslttppcsegvrwivfkepvemsreqlekfrkvmgfdnnrpvqpl
    narkvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uovA (A:)
    gahwgysgsigpehwgdlspeylmckigknqspidinsadavkaclapvsvyyvsdakyv
    vnnghtikvvmggrgyvvvdgkrfylkqfhfhapsehtvngkhypfeahfvhldkngnit
    vlgvffkvgkenpelekvwrvmpeepgqkrhltaridpekllpenrdyyrysgslttppc
    segvrwivfkepvemsreqlekfrkvmgfdnnrpvqplnarkvmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uovB (B:)
    mkrvlvtlgavaalatgavagggahwgysgsigpehwgdlspeylmckigknqspidins
    adavkaclapvsvyyvsdakyvvnnghtikvvmggrgyvvvdgkrfylkqfhfhapseht
    vngkhypfeahfvhldkngnitvlgvffkvgkenpelekvwrvmpeepgqkrhltaridp
    ekllpenrdyyrysgslttppcsegvrwivfkepvemsreqlekfrkvmgfdnnrpvqpl
    narkvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uovB (B:)
    gahwgysgsigpehwgdlspeylmckigknqspidinsadavkaclapvsvyyvsdakyv
    vnnghtikvvmggrgyvvvdgkrfylkqfhfhapsehtvngkhypfeahfvhldkngnit
    vlgvffkvgkenpelekvwrvmpeepgqkrhltaridpekllpenrdyyrysgslttppc
    segvrwivfkepvemsreqlekfrkvmgfdnnrpvqplnarkvmk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4uovC (C:)
    mkrvlvtlgavaalatgavagggahwgysgsigpehwgdlspeylmckigknqspidins
    adavkaclapvsvyyvsdakyvvnnghtikvvmggrgyvvvdgkrfylkqfhfhapseht
    vngkhypfeahfvhldkngnitvlgvffkvgkenpelekvwrvmpeepgqkrhltaridp
    ekllpenrdyyrysgslttppcsegvrwivfkepvemsreqlekfrkvmgfdnnrpvqpl
    narkvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uovC (C:)
    gahwgysgsigpehwgdlspeylmckigknqspidinsadavkaclapvsvyyvsdakyv
    vnnghtikvvmggrgyvvvdgkrfylkqfhfhapsehtvngkhypfeahfvhldkngnit
    vlgvffkvgkenpelekvwrvmpeepgqkrhltaridpekllpenrdyyrysgslttppc
    segvrwivfkepvemsreqlekfrkvmgfdnnrpvqplnarkvmk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4uovD (D:)
    mkrvlvtlgavaalatgavagggahwgysgsigpehwgdlspeylmckigknqspidins
    adavkaclapvsvyyvsdakyvvnnghtikvvmggrgyvvvdgkrfylkqfhfhapseht
    vngkhypfeahfvhldkngnitvlgvffkvgkenpelekvwrvmpeepgqkrhltaridp
    ekllpenrdyyrysgslttppcsegvrwivfkepvemsreqlekfrkvmgfdnnrpvqpl
    narkvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uovD (D:)
    gahwgysgsigpehwgdlspeylmckigknqspidinsadavkaclapvsvyyvsdakyv
    vnnghtikvvmggrgyvvvdgkrfylkqfhfhapsehtvngkhypfeahfvhldkngnit
    vlgvffkvgkenpelekvwrvmpeepgqkrhltaridpekllpenrdyyrysgslttppc
    segvrwivfkepvemsreqlekfrkvmgfdnnrpvqplnarkvmk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4uovE (E:)
    mkrvlvtlgavaalatgavagggahwgysgsigpehwgdlspeylmckigknqspidins
    adavkaclapvsvyyvsdakyvvnnghtikvvmggrgyvvvdgkrfylkqfhfhapseht
    vngkhypfeahfvhldkngnitvlgvffkvgkenpelekvwrvmpeepgqkrhltaridp
    ekllpenrdyyrysgslttppcsegvrwivfkepvemsreqlekfrkvmgfdnnrpvqpl
    narkvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uovE (E:)
    gahwgysgsigpehwgdlspeylmckigknqspidinsadavkaclapvsvyyvsdakyv
    vnnghtikvvmggrgyvvvdgkrfylkqfhfhapsehtvngkhypfeahfvhldkngnit
    vlgvffkvgkenpelekvwrvmpeepgqkrhltaridpekllpenrdyyrysgslttppc
    segvrwivfkepvemsreqlekfrkvmgfdnnrpvqplnarkvmk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4uovF (F:)
    mkrvlvtlgavaalatgavagggahwgysgsigpehwgdlspeylmckigknqspidins
    adavkaclapvsvyyvsdakyvvnnghtikvvmggrgyvvvdgkrfylkqfhfhapseht
    vngkhypfeahfvhldkngnitvlgvffkvgkenpelekvwrvmpeepgqkrhltaridp
    ekllpenrdyyrysgslttppcsegvrwivfkepvemsreqlekfrkvmgfdnnrpvqpl
    narkvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uovF (F:)
    gahwgysgsigpehwgdlspeylmckigknqspidinsadavkaclapvsvyyvsdakyv
    vnnghtikvvmggrgyvvvdgkrfylkqfhfhapsehtvngkhypfeahfvhldkngnit
    vlgvffkvgkenpelekvwrvmpeepgqkrhltaridpekllpenrdyyrysgslttppc
    segvrwivfkepvemsreqlekfrkvmgfdnnrpvqplnarkvmk