PDB entry 4uo8

View 4uo8 on RCSB PDB site
Description: Structure of the A_Canine_Colorado_17864_06 H3 haemagglutinin in complex with 6SO4-3SLN
Class: viral protein
Keywords: viral protein, equine
Deposited on 2014-05-31, released 2014-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.20926
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ha1
    Species: INFLUENZA A VIRUS (A/CANINE/COLORADO/17864/2006(H3N8)) [TaxId:867285]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uo8a_
  • Chain 'B':
    Compound: ha2
    Species: INFLUENZA A VIRUS (A/CANINE/COLORADO/17864/2006(H3N8)) [TaxId:867285]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0UVR5 (0-171)
      • expression tag (172-174)
      • conflict (130)
    Domains in SCOPe 2.07: d4uo8b1, d4uo8b2
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uo8A (A:)
    qnpisgnntatlclghhavangtlvktmsddqievtnatelvqsismgkicnksyrildg
    rnctlidamlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtveft
    aegftwtgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwg
    ihhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgd
    ilminsngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvt
    ygkcpkyirqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uo8A (A:)
    nntatlclghhavangtlvktmsddqievtnatelvqsismgkicnksyrildgrnctli
    damlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtveftaegftw
    tgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwgihhpss
    nqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvtygkcpk
    yirqntlklatgmrnvpek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uo8B (B:)
    gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
    ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfqsgr