PDB entry 4uo5

View 4uo5 on RCSB PDB site
Description: Structure of the A_Canine_Colorado_17864_06 H3 haemagglutinin in complex with 3SLN
Class: viral protein
Keywords: viral protein
Deposited on 2014-05-31, released 2014-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.19872
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h3 haemagglutinin ha1 chain
    Species: INFLUENZA A VIRUS [TaxId:867285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uo5a_
  • Chain 'B':
    Compound: h3 haemagglutinin ha2 chain
    Species: INFLUENZA A VIRUS [TaxId:867285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0UVR5 (0-171)
      • expression tag (172-174)
      • conflict (130)
    Domains in SCOPe 2.07: d4uo5b1, d4uo5b2
  • Chain 'C':
    Compound: h3 haemagglutinin ha1 chain
    Species: INFLUENZA A VIRUS [TaxId:867285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uo5c_
  • Chain 'D':
    Compound: h3 haemagglutinin ha2 chain
    Species: INFLUENZA A VIRUS [TaxId:867285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0UVR5 (0-171)
      • expression tag (172-174)
      • conflict (130)
    Domains in SCOPe 2.07: d4uo5d1, d4uo5d2
  • Chain 'E':
    Compound: h3 haemagglutinin ha1 chain
    Species: INFLUENZA A VIRUS [TaxId:867285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uo5e_
  • Chain 'F':
    Compound: h3 haemagglutinin ha2 chain
    Species: INFLUENZA A VIRUS [TaxId:867285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0UVR5 (0-171)
      • expression tag (172-174)
      • conflict (130)
    Domains in SCOPe 2.07: d4uo5f1, d4uo5f2
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uo5A (A:)
    qnpisgnntatlclghhavangtlvktmsddqievtnatelvqsismgkicnksyrildg
    rnctlidamlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtveft
    aegftwtgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwg
    ihhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgd
    ilminsngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvt
    ygkcpkyirqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uo5A (A:)
    nntatlclghhavangtlvktmsddqievtnatelvqsismgkicnksyrildgrnctli
    damlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtveftaegftw
    tgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwgihhpss
    nqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvtygkcpk
    yirqntlklatgmrnvpek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uo5B (B:)
    gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
    ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfqsgr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4uo5C (C:)
    qnpisgnntatlclghhavangtlvktmsddqievtnatelvqsismgkicnksyrildg
    rnctlidamlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtveft
    aegftwtgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwg
    ihhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgd
    ilminsngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvt
    ygkcpkyirqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uo5C (C:)
    nntatlclghhavangtlvktmsddqievtnatelvqsismgkicnksyrildgrnctli
    damlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtveftaegftw
    tgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwgihhpss
    nqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvtygkcpk
    yirqntlklatgmrnvpek
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uo5D (D:)
    gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
    ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfqsgr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4uo5E (E:)
    qnpisgnntatlclghhavangtlvktmsddqievtnatelvqsismgkicnksyrildg
    rnctlidamlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtveft
    aegftwtgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwg
    ihhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgd
    ilminsngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvt
    ygkcpkyirqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uo5E (E:)
    nntatlclghhavangtlvktmsddqievtnatelvqsismgkicnksyrildgrnctli
    damlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtveftaegftw
    tgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwgihhpss
    nqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
    ngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvtygkcpk
    yirqntlklatgmrnvpek
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uo5F (F:)
    gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
    ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfqsgr