PDB entry 4unz

View 4unz on RCSB PDB site
Description: Structure of the A_Equine_Newmarket_2_93 H3 haemagglutinin in complex with 6SO4-Sialyl Lewis X
Class: viral protein
Keywords: viral protein, influenza
Deposited on 2014-05-31, released 2014-07-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.20088
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hay subunit of haemagglutinin
  Species: INFLUENZA A VIRUS (A/EQ/NEWMARKET/93/(H3N8)) [TaxId:159470]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q82847
• Chain 'B':
  Compound: h3 haemagglutinin ha2 chain
  Species: INFLUENZA A VIRUS (A/EQ/NEWMARKET/93/(H3N8)) [TaxId:159470]
  Database cross-references and differences (RAF-indexed):
  • PDB 4UNZ (0-172)
  Domains in SCOPe 2.04: d4unzb_
• Chain 'C':
  Compound: hay subunit of haemagglutinin
  Species: INFLUENZA A VIRUS (A/EQ/NEWMARKET/93/(H3N8)) [TaxId:159470]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q82847 (2-329)
    • expression tag (0-1)
  Domains in SCOPe 2.04: d4unzc_
• Chain 'D':
  Compound: h3 haemagglutinin ha2 chain
  Species: INFLUENZA A VIRUS (A/EQ/NEWMARKET/93/(H3N8)) [TaxId:159470]
  Database cross-references and differences (RAF-indexed):
  • PDB 4UNZ (0-End)
• Chain 'E':
  Compound: hay subunit of haemagglutinin
  Species: INFLUENZA A VIRUS (A/EQ/NEWMARKET/93/(H3N8)) [TaxId:159470]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q82847
• Chain 'F':
  Compound: h3 haemagglutinin ha2 chain
  Species: INFLUENZA A VIRUS (A/EQ/NEWMARKET/93/(H3N8)) [TaxId:159470]
  Database cross-references and differences (RAF-indexed):
  • PDB 4UNZ (0-End)
• Heterogens: NAG, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4unzB (B:)
  gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
  ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
  ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfqi
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4unzC (C:)
  pdqnptsgnntatlclghhavangtlvktitddqievtnatelvqsisigkicnnsyrvl
  dgrnctlidamlgdphcddfqyenwdlfierssafsncypydipdyaslrsivassgtle
  ftaegftwtgvtqnggsgackrgsadsffsrlnwltksgnsypilnvtmpnnknfdklyi
  wgihhpssnkeqtklyiqesgrvtvstersqqtvipnigsrpwvrgqsgrisiywtivkp
  gdilminsngnlvaprgyfklrtgkssvmrsdalidtcvsecitpngsipndkpfqnvnk
  itygkcpkyirqntlklatgmrnvpekqir
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.