PDB entry 4und

View 4und on RCSB PDB site
Description: human artd1 (parp1) - catalytic domain in complex with inhibitor talazoparib
Class: transferase
Keywords: transferase, protein-inhibitor complex, ADP-ribosylation, DNA repair
Deposited on 2014-05-27, released 2015-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09874 (23-End)
      • expression tag (16-22)
      • variant (123)
    Domains in SCOPe 2.08: d4unda1, d4unda2, d4unda3
  • Chain 'B':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09874 (23-End)
      • variant (123)
    Domains in SCOPe 2.08: d4undb1, d4undb2
  • Heterogens: 2YQ, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4undA (A:)
    mhhhhhhssgvdlgtenlyfqsmksklpkpvqdlikmifdvesmkkamveyeidlqkmpl
    gklskrqiqaaysilsevqqavsqgssdsqildlsnrfytliphdfgmkkppllnnadsv
    qakaemldnlldievaysllrggsddsskdpidvnyeklktdikvvdrdseeaeiirkyv
    knthatthnaydlevidifkieregecqrykpfkqlhnrrllwhgsrttnfagilsqglr
    iappeapvtgymfgkgiyfadmvsksanychtsqgdpiglillgevalgnmyelkhashi
    sklpkgkhsvkglgkttpdpsanisldgvdvplgtgissgvndtsllyneyivydiaqvn
    lkyllklkfnfkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4undA (A:)
    nlyfqsmksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysils
    evqqavsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldieva
    ysllrggsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevi
    difkieregecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkg
    iyfadmvsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkt
    tpdpsanisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4undB (B:)
    mhhhhhhssgvdlgtenlyfqsmksklpkpvqdlikmifdvesmkkamveyeidlqkmpl
    gklskrqiqaaysilsevqqavsqgssdsqildlsnrfytliphdfgmkkppllnnadsv
    qakaemldnlldievaysllrggsddsskdpidvnyeklktdikvvdrdseeaeiirkyv
    knthatthnaydlevidifkieregecqrykpfkqlhnrrllwhgsrttnfagilsqglr
    iappeapvtgymfgkgiyfadmvsksanychtsqgdpiglillgevalgnmyelkhashi
    sklpkgkhsvkglgkttpdpsanisldgvdvplgtgissgvndtsllyneyivydiaqvn
    lkyllklkfnfkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4undB (B:)
    ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
    qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
    sddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkier
    egecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmv
    sksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsan
    isldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfk